| IED ID | IndEnz0002010144 |
| Enzyme Type ID | protease010144 |
| Protein Name |
Stage IV sporulation protein FB EC 3.4.24.- |
| Gene Name | spoIVFB bofB BSU27970 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MNKWLDLILKIHVHPFLWIIAALGLLTGHMKALLCLLLIVLIHELGHAALAVFFSWRIKRVFLLPFGGTVEVEEHGNRPLKEEFAVIIAGPLQHIWLQFAAWMLAEVSVIHQHTFELFTFYNLSILFVNLLPIWPLDGGKLLFLLFSKQLPFQKAHRLNLKTSLCFCLLLGCWVLFVIPLQISAWVLFVFLAVSLFEEYRQRHYIHVRFLLERYYGKNRELEKLLPLTVKAEDKVYHVMAEFKRGCKHPIIIEKSGQKLSQLDENEVLHAYFADKRTNSSMEELLLPY |
| Enzyme Length | 288 |
| Uniprot Accession Number | P26937 |
| Absorption | |
| Active Site | ACT_SITE 44; /evidence=ECO:0000305 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: Implicated in the coupling of mother cell to forespore gene expression. Required for spore formation. Processes the pro-sigma K factor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (3); Mutagenesis (4); Topological domain (7); Transmembrane (6) |
| Keywords | Hydrolase;Membrane;Metal-binding;Metalloprotease;Protease;Reference proteome;Sporulation;Transmembrane;Transmembrane helix;Zinc |
| Interact With | P12254 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Forespore outer membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 33,640 |
| Kinetics | |
| Metal Binding | METAL 43; /note=Zinc; catalytic; /evidence=ECO:0000305; METAL 47; /note=Zinc; catalytic; /evidence=ECO:0000305; METAL 137; /note=Zinc; catalytic; /evidence=ECO:0000305 |
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.116;3.4.24.B23; |