| IED ID | IndEnz0002010144 | 
| Enzyme Type ID | protease010144 | 
| Protein Name | Stage IV sporulation protein FB EC 3.4.24.- | 
| Gene Name | spoIVFB bofB BSU27970 | 
| Organism | Bacillus subtilis (strain 168) | 
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) | 
| Enzyme Sequence | MNKWLDLILKIHVHPFLWIIAALGLLTGHMKALLCLLLIVLIHELGHAALAVFFSWRIKRVFLLPFGGTVEVEEHGNRPLKEEFAVIIAGPLQHIWLQFAAWMLAEVSVIHQHTFELFTFYNLSILFVNLLPIWPLDGGKLLFLLFSKQLPFQKAHRLNLKTSLCFCLLLGCWVLFVIPLQISAWVLFVFLAVSLFEEYRQRHYIHVRFLLERYYGKNRELEKLLPLTVKAEDKVYHVMAEFKRGCKHPIIIEKSGQKLSQLDENEVLHAYFADKRTNSSMEELLLPY | 
| Enzyme Length | 288 | 
| Uniprot Accession Number | P26937 | 
| Absorption | |
| Active Site | ACT_SITE 44; /evidence=ECO:0000305 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- | 
| Enzyme Function | FUNCTION: Implicated in the coupling of mother cell to forespore gene expression. Required for spore formation. Processes the pro-sigma K factor. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Metal binding (3); Mutagenesis (4); Topological domain (7); Transmembrane (6) | 
| Keywords | Hydrolase;Membrane;Metal-binding;Metalloprotease;Protease;Reference proteome;Sporulation;Transmembrane;Transmembrane helix;Zinc | 
| Interact With | P12254 | 
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Forespore outer membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 33,640 | 
| Kinetics | |
| Metal Binding | METAL 43; /note=Zinc; catalytic; /evidence=ECO:0000305; METAL 47; /note=Zinc; catalytic; /evidence=ECO:0000305; METAL 137; /note=Zinc; catalytic; /evidence=ECO:0000305 | 
| Rhea ID | |
| Cross Reference Brenda | 3.4.21.116;3.4.24.B23; |