| IED ID | IndEnz0002010145 | 
| Enzyme Type ID | protease010145 | 
| Protein Name | Venom protease EC 3.4.21.- allergen Bom p 4 | 
| Gene Name | |
| Organism | Bombus pensylvanicus (American bumblebee) (Apis pensylvanica) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Hymenoptera Apocrita (wasps ants and bees) Aculeata Apoidea (bees) Apidae (bumble bees and honey bees) Apinae (honey bees) Bombini Bombus (bumble bees) Fervidobombus Bombus pensylvanicus (American bumblebee) (Apis pensylvanica) | 
| Enzyme Sequence | VVGGKPAKLGAWPWMVALGFHNYRQPKKSPEWKCGGSLRISRHVLTAAHCAIHRSLYVVRIADLNLKRDDDGAHPIQMGIESKLIHPDYVYSEHHDDIAILKLEKDVSFSEYIRPICLPIEESLRNNNFIGYNPFVAGWGRLRYKGPLSDALMEVQVPVVRNKVCKRAYSDVSDTVICAGYPKGRKDSCQGDSGGPLMIPQESTYYEIGVVSYGHECALPKYPGVYTRVTSYLDSFILPALKK | 
| Enzyme Length | 243 | 
| Uniprot Accession Number | Q7M4I3 | 
| Absorption | |
| Active Site | ACT_SITE 49; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 97; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 193; /note=Charge relay system; /evidence=ECO:0000250 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- | 
| Enzyme Function | |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (3); Domain (1) | 
| Keywords | Allergen;Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Secreted;Serine protease | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 27,251 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |