| IED ID | IndEnz0002010168 |
| Enzyme Type ID | protease010168 |
| Protein Name |
Transcriptional regulator SlyA Homolog of Rap Hor-Er |
| Gene Name | slyA hor |
| Organism | Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Pectobacteriaceae Pectobacterium Pectobacterium carotovorum (Erwinia carotovora) Pectobacterium carotovorum subsp. carotovorum (Erwinia carotovora subsp. carotovora) |
| Enzyme Sequence | MELPLGSDLARLVRVWRALVDHRLKPLELTQTHWVTLHNIYHLPPGQSQIQLAKAIGIEQPSLVRTLDQLEEKGLITRHVCAHDRRAKRIMLTESAEPIIQAVNGVISHTRSEVLFGITPEQVDELALLVSRLEKNILALHENQA |
| Enzyme Length | 145 |
| Uniprot Accession Number | Q9RB09 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | DNA_BIND 49..72; /note=H-T-H motif; /evidence=ECO:0000255|HAMAP-Rule:MF_01819 |
| EC Number | |
| Enzyme Function | FUNCTION: Transcription regulator that can specifically activate or repress expression of target genes (By similarity). Regulates genes involved in production of antibiotic and exoenzyme virulence determinants in the phytopathogen (PubMed:9402023). Required for the expression of the virulence protein evf during Drosophila melanogaster infection (PubMed:12612613). {ECO:0000255|HAMAP-Rule:MF_01819, ECO:0000269|PubMed:12612613, ECO:0000305|PubMed:9402023}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); DNA binding (1); Domain (1) |
| Keywords | Activator;Antibiotic biosynthesis;DNA-binding;Repressor;Transcription;Transcription regulation;Virulence |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 16,417 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |