| IED ID | IndEnz0002010172 |
| Enzyme Type ID | protease010172 |
| Protein Name |
SPARC Basement-membrane protein 40 BM-40 Osteonectin ON Secreted protein acidic and rich in cysteine |
| Gene Name | ost-1 sparc C44B12.2 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MRYALAACLLLLAASSFVDAKKKKIADDELGELLDNIDADEEKKSVEPAKNPCEDHQCGWGKECVVGKKGEPTCECISKCPELDGDPMDKVCANNNQTFTSLCDLYRERCLCKRKSKECSKAFNAKVHLEYLGECKKLDECTEEHMAQFPERMADWLFQVMKELKKRRELHKLEWEELLSEAENDDEKKHVYPVIWKFCELDTKPHDKSVSHHELIPITAPVIPMESCIKPFLEGCDANNDGNISIKEWGKCLGLKEGEIQERC |
| Enzyme Length | 264 |
| Uniprot Accession Number | P34714 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | CA_BIND 237..248; /evidence=ECO:0000250 |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Has a high affinity for collagen. Affects nematode body morphology and mobility. Essential for C.elegans development and muscle function. The cysteine-rich region could have protease inhibitory activity or may provide the framework for a protein binding module. Probable role in skeletal morphogenesis. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Calcium binding (1); Chain (1); Disulfide bond (7); Domain (3); Glycosylation (2); Signal peptide (1) |
| Keywords | Basement membrane;Calcium;Copper;Developmental protein;Disulfide bond;Extracellular matrix;Glycoprotein;Metal-binding;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space, extracellular matrix, basement membrane {ECO:0000250}. Note=In or around the basement membrane. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..16; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11231151; 15338614; 17486083; 17850180; 21177967; 22560298; 23800452; 25487147; 26009280; 26926673; 29348603; 7760737; 9822581; |
| Motif | |
| Gene Encoded By | |
| Mass | 30,173 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |