| IED ID | IndEnz0002010176 |
| Enzyme Type ID | protease010176 |
| Protein Name |
Sortase D EC 3.4.22.- |
| Gene Name | srtD srtA yhcS BSU09200 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MKKVIPLFIIAAGLVIAGYGGFKLIDTNTKTEQTLKEAKLAAKKPQEASGTKNSTDQAKNKASFKPETGQASGILEIPKINAELPIVEGTDADDLEKGVGHYKDSYYPDENGQIVLSGHRDTVFRRTGELEKGDQLRLLLSYGEFTYEIVKTKIVDKDDTSIITLQHEKEELILTTCYPFSYVGNAPKRYIIYGKRVT |
| Enzyme Length | 198 |
| Uniprot Accession Number | P54603 |
| Absorption | |
| Active Site | ACT_SITE 119; /note=Proton donor/acceptor; /evidence=ECO:0000250|UniProtKB:Q2FV99; ACT_SITE 177; /note=Acyl-thioester intermediate; /evidence=ECO:0000250|UniProtKB:Q2FV99 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Transpeptidase that anchors surface proteins to the cell wall (PubMed:21906378, PubMed:21800427, PubMed:22020651). Recognizes and modifies its substrate by proteolytic cleavage of a C-terminal sorting signal. Following cleavage, a covalent intermediate is formed via a thioester bond between the sortase and its substrate, which is then transferred and covalently attached to the cell wall (Probable). This sortase recognizes a Leu-Pro-Asp-Thr-Ser/Ala (LPDTS/A) motif (PubMed:21906378, PubMed:22020651). It has two substrates, YhcR and YfkN (PubMed:21906378, PubMed:21800427, PubMed:22020651). {ECO:0000269|PubMed:21800427, ECO:0000269|PubMed:21906378, ECO:0000269|PubMed:22020651, ECO:0000305|PubMed:21800427, ECO:0000305|PubMed:21906378, ECO:0000305|PubMed:22020651}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Compositional bias (1); Region (1); Site (1); Transmembrane (1) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Thiol protease;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | INDUCTION: Preferentially expressed in the late stationary phase. {ECO:0000269|PubMed:21906378}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:22020651}; Single-pass type II membrane protein {ECO:0000305}. Note=Nonuniformly distributed around the cell periphery in the form of patches or short arcs. {ECO:0000269|PubMed:22020651}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,976 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |