Detail Information for IndEnz0002010184
IED ID IndEnz0002010184
Enzyme Type ID protease010184
Protein Name Secreted phosphoprotein 24
Spp-24
Secreted phosphoprotein 2
Gene Name SPP2 SPP24
Organism Homo sapiens (Human)
Taxonomic Lineage cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human)
Enzyme Sequence MISRMEKMTMMMKILIMFALGMNYWSCSGFPVYDYDPSSLRDALSASVVKVNSQSLSPYLFRAFRSSLKRVEVLDENNLVMNLEFSIRETTCRKDSGEDPATCAFQRDYYVSTAVCRSTVKVSAQQVQGVHARCSWSSSTSESYSSEEMIFGDMLGSHKWRNNYLFGLISDESISEQFYDRSLGIMRRVLPPGNRRYPNHRHRARINTDFE
Enzyme Length 211
Uniprot Accession Number Q13103
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Could coordinate an aspect of bone turnover. {ECO:0000250}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Chain (1); Disulfide bond (2); Modified residue (6); Natural variant (1); Sequence conflict (1); Signal peptide (1)
Keywords Disulfide bond;Phosphoprotein;Reference proteome;Secreted;Signal
Interact With
Induction
Subcellular Location SUBCELLULAR LOCATION: Secreted.
Modified Residue MOD_RES 96; /note=Phosphoserine; /evidence=ECO:0007744|PubMed:24275569; MOD_RES 145; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q62740; MOD_RES 146; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q62740; MOD_RES 170; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q8K1I3; MOD_RES 173; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q8K1I3; MOD_RES 182; /note=Phosphoserine; /evidence=ECO:0000250|UniProtKB:Q62740
Post Translational Modification PTM: Phosphorylation sites are present in the extracellular medium.
Signal Peptide SIGNAL 1..29; /evidence=ECO:0000255
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID 1435334; 19240061; 19375587; 25339413; 25418420; 25501958; 26091039; 26459573; 27793899; 31849319; 33481052;
Motif
Gene Encoded By
Mass 24,338
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda