| IED ID | IndEnz0002010226 |
| Enzyme Type ID | protease010226 |
| Protein Name |
Cysteine protease StiP EC 3.4.22.- |
| Gene Name | stiP ACIAD1960 |
| Organism | Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Moraxellales Moraxellaceae Acinetobacter Acinetobacter baylyi Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) |
| Enzyme Sequence | MAIINKDKATELILKQGFSGSYQSEQVTFLLKRTHIEPTDTAEKERLIQSGEKHYSQMISLENAPTARHLELFEQAMQQGQQRLAQEVQQLAQTLVVEFNEPIVLVSFVRAGVPLGVLLYHAIQDLGRDCVHYGISIIRDRGIDFAALETIIARHGHASIVFVDGWTGKGAIRQELQRSLGNDTRFIGKPLPLVVLSDIAGCAWLAASGDDWLIPSGILGSTISGLISRSICEGETLSADEITAENIDQWHRCIEYHHLKEFDISQQFIQRINQIRLKLNPQSNAVWAETQQQAQQDQSQQVVHKLAQEYDIQNINRIKPSIAEATRAILRRVPDLVLLRDADDEDTRLLRHLTQITKTPVQVVGDQIAPYRAITLIQKLGKG |
| Enzyme Length | 383 |
| Uniprot Accession Number | Q6FAX7 |
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: Is inhibited by bromopyruvate in vitro. Activity is not affected by the presence of tellurite. {ECO:0000269|PubMed:24206355}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Cysteine protease that may play a role in regulating cell morphology in response to stressful conditions which likely cause oxidative damage. Appears to catalyze its own cleavage, which probably leads to its activation. {ECO:0000269|PubMed:24206355}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Propeptide (1) |
| Keywords | Autocatalytic cleavage;Hydrolase;Protease;Reference proteome;Thiol protease |
| Interact With | |
| Induction | INDUCTION: Highly induced by starvation during long-term stationary phase, while shows very low expression during exponential growth. {ECO:0000269|PubMed:20511417}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | PTM: Is probably processed via an autocatalytic removal of a proregion of about 100 amino acids. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 42,995 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |