| IED ID | IndEnz0002010245 |
| Enzyme Type ID | protease010245 |
| Protein Name |
Mediator of RNA polymerase II transcription subunit 4 Mediator complex subunit 4 YlMED4 |
| Gene Name | MED4 YALI0F01144g |
| Organism | Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Saccharomycotina (true yeasts) Saccharomycetes Saccharomycetales Dipodascaceae Yarrowia Yarrowia lipolytica (Candida lipolytica) Yarrowia lipolytica (strain CLIB 122 / E 150) (Yeast) (Candida lipolytica) |
| Enzyme Sequence | MNSTPANSTPLPPLQPFTPGSSAATPAPIALTRSKPRRRLSSNVVGVSDRRRLLQMLQNVEEVSPGPDSASEAGESPSIRSQDEAHLEHLSSARICMDEDKELLIHQALPAFENTLLRFVQALSKYDFRQDLAETLMETESQFCEAVDELVEHQQAAQTIAALERVSEGLDDKIRDMIRKLAECRRELRNYQPNNENQSTLSSADLLTYATRIANFTTAPPYFRERPEHSKLPWPIEDEMRKGLLALMEVGKDKTELGELADPEKFAHTAANGVAPNGAAPVANGVAQNHNNGYAMERRLSTGYGSDNDGDTNMNGRSGLAGLDIFDDDDDDDDDD |
| Enzyme Length | 336 |
| Uniprot Accession Number | Q8WZL6 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Coiled coil (1); Region (3) |
| Keywords | Activator;Coiled coil;Nucleus;Reference proteome;Transcription;Transcription regulation |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 37,035 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |