| IED ID | IndEnz0002010247 | 
| Enzyme Type ID | protease010247 | 
| Protein Name | Penicillin-insensitive murein endopeptidase EC 3.4.24.- D-alanyl-D-alanine-endopeptidase DD-endopeptidase | 
| Gene Name | mepA SbBS512_E2706 | 
| Organism | Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) | 
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Shigella Shigella boydii Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) | 
| Enzyme Sequence | MNKTAIALLALLASSASLAATPWQKITQPVPGSAQSIGSFSNGCIVGADTLPIQSEHYQVMRTDQRRYFGHPDLVMFIQRLSSQVSNLGMGTVLIGDMGMPAGGRFNGGHASHQTGLDVDIFLQLPKTRWTSAQLLRPQALDLVSRDGKHVVSTLWKPEIFSLIKLAAQDKDVTRIFVNPAIKQQLCLDAGTDRDWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPPGDGCGAELQSWFAPPKPGTTKPEKKTPPPLPPSCQALLDEHVI | 
| Enzyme Length | 274 | 
| Uniprot Accession Number | B2TWB0 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- | 
| Enzyme Function | FUNCTION: Murein endopeptidase that cleaves the D-alanyl-meso-2,6-diamino-pimelyl amide bond that connects peptidoglycan strands. Likely plays a role in the removal of murein from the sacculus. {ECO:0000255|HAMAP-Rule:MF_01623}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Disulfide bond (3); Metal binding (6); Region (1); Signal peptide (1) | 
| Keywords | Disulfide bond;Hydrolase;Metal-binding;Metalloprotease;Periplasm;Protease;Signal;Zinc | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000255|HAMAP-Rule:MF_01623}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255|HAMAP-Rule:MF_01623 | 
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 30,089 | 
| Kinetics | |
| Metal Binding | METAL 110; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 113; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 120; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 147; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 150; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 211; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623 | 
| Rhea ID | |
| Cross Reference Brenda |