| IED ID | IndEnz0002010290 | 
| Enzyme Type ID | protease010290 | 
| Protein Name | Snake venom serine protease PA SVSP EC 3.4.21.- | 
| Gene Name | |
| Organism | Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Trimeresurus Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri) | 
| Enzyme Sequence | MVLIRVLANLLILQLSYAQKSPELVVGGDECNINEHRSLVAIFNSTGFFCSGTLINQEWVVTAAHCDSNNFKMKFGAHSQKVLNEDEQIRNPKEKFICPNKKNNEVLDKDIMLIKLDSSVSNSEHIAPLSLPSSPPSVGSVCRIMGWGSITPTKVTYPDVPYCANINLLDDAECKPGYPELLPEYRTLCAGIVQGGKDTCGGDSGGPLICNGQFHGIVSYGAHPCGQSLKPGIYTTVFDYNDWIKSIIAGNTAATCPP | 
| Enzyme Length | 258 | 
| Uniprot Accession Number | Q71QH7 | 
| Absorption | |
| Active Site | ACT_SITE 65; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 110; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 204; /note=Charge relay system; /evidence=ECO:0000250 | 
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- | 
| Enzyme Function | FUNCTION: Snake venom serine protease that may act in the hemostasis system of the prey. {ECO:0000250}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (1); Propeptide (1); Signal peptide (1) | 
| Keywords | Disulfide bond;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Protease;Secreted;Serine protease;Signal;Toxin;Zymogen | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 | 
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 27,951 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |