| IED ID | IndEnz0002010301 | 
| Enzyme Type ID | protease010301 | 
| Protein Name | Kunitz-type U15-theraphotoxin-Hhn1k U15-TRTX-Hhn1k Kunitz-type serine protease inhibitor hainantoxin-XI-11 HNTX-XI-11 | 
| Gene Name | |
| Organism | Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Araneae (spiders) Mygalomorphae (mygalomorph spiders) Theraphosidae (tarantulas) Haplopelma Cyriopagopus hainanus (Chinese bird spider) (Haplopelma hainanum) | 
| Enzyme Sequence | MGTARFLRAVLLLSVLLMVTFPALLSAEHHDGRVDICRLPSDSGDCLRFFEMWCFDGTTCTKFVYGGYGGNDNRFPTEKACMKRCAKA | 
| Enzyme Length | 88 | 
| Uniprot Accession Number | D2Y2G2 | 
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that inhibits chymotrypsin and blocks voltage-gated potassium channels (Kv). {ECO:0000250}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Disulfide bond (2); Domain (1); Peptide (1); Propeptide (1); Signal peptide (1); Site (1) | 
| Keywords | Disulfide bond;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin;Voltage-gated potassium channel impairing toxin | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 | 
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 9,831 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |