| IED ID | IndEnz0002010311 |
| Enzyme Type ID | protease010311 |
| Protein Name |
Kunitz-type serine protease inhibitor homolog dendrotoxin K DTX-K Venom basic protease inhibitor K Fragment |
| Gene Name | |
| Organism | Dendroaspis polylepis polylepis (Black mamba) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Elapinae Dendroaspis Dendroaspis polylepis Dendroaspis polylepis polylepis (Black mamba) |
| Enzyme Sequence | SGHLLLLLGLLTLWAELTPVSGAAKYCKLPLRIGPCKRKIPSFYYKWKAKQCLPFDYSGCGGNANRFKTIEECRRTCVG |
| Enzyme Length | 79 |
| Uniprot Accession Number | P00981 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor homolog that selectively blocks voltage-gated potassium channels homooligomer Kv1.1/KCNA1 (EC(50)=0.6 nM) and Kv1.1-containing heterooligomer. {ECO:0000269|PubMed:10429207, ECO:0000269|PubMed:8612784, ECO:0000269|PubMed:9134213}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (3); Domain (1); Helix (2); Mutagenesis (17); Non-terminal residue (1); Propeptide (1); Signal peptide (1); Site (4); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Neurotoxin;Potassium channel impairing toxin;Secreted;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL <1..? |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1DTK; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 8,852 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |