| IED ID |
IndEnz0002010321 |
| Enzyme Type ID |
protease010321 |
| Protein Name |
DNA-binding protein HRm
|
| Gene Name |
hupB R01258 SMc01906 |
| Organism |
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Proteobacteria
Alphaproteobacteria
Hyphomicrobiales
Rhizobiaceae
Sinorhizobium/Ensifer group
Sinorhizobium
Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti)
Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti)
|
| Enzyme Sequence |
MNKNELVAAVADKAGLSKADASSAVDAVFETIQGELKNGGDIRLVGFGNFSVSRREASKGRNPSTGAEVDIPARNVPKFTAGKGLKDAVN |
| Enzyme Length |
90 |
| Uniprot Accession Number |
P02344 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Histone-like DNA-binding protein which is capable of wrapping DNA to stabilize it, and thus to prevent its denaturation under extreme environmental conditions. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Sequence conflict (2) |
| Keywords |
DNA condensation;DNA-binding;Direct protein sequencing;Reference proteome |
| Interact With |
|
| Induction |
|
| Subcellular Location |
|
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
|
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
9,303 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|