| IED ID | IndEnz0002010329 |
| Enzyme Type ID | protease010329 |
| Protein Name |
Cystatin-1 Cystatin JZTX-75 |
| Gene Name | |
| Organism | Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Chelicerata Arachnida Araneae (spiders) Mygalomorphae (mygalomorph spiders) Theraphosidae (tarantulas) Chilobrachys Chilobrachys guangxiensis (Chinese earth tiger tarantula) (Chilobrachys jingzhao) |
| Enzyme Sequence | MKAIYLILTVLCGFSASTKTGGWRDKDVDDEDIRKFATLAASENSKMSNSLYFEKLVKVIEAKSQVVSGVKYNITFEIAPTECKKNGKGYDKLSECPLLESAPHQTCTAIIWTRSWLNDTQILKLKCKEGGSSC |
| Enzyme Length | 134 |
| Uniprot Accession Number | B1P1J3 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Inhibits various C1 cysteine proteases. This protein has no toxic activity and its function in the venom is unknown. It may play a role as a housekeeping or regulatory protein (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Motif (1); Signal peptide (1); Site (1) |
| Keywords | Disulfide bond;Protease inhibitor;Secreted;Signal;Thiol protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 65..69; /note=Secondary area of contact; /evidence=ECO:0000250 |
| Gene Encoded By | |
| Mass | 14,879 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |