| IED ID | IndEnz0002010353 |
| Enzyme Type ID | protease010353 |
| Protein Name |
Serine protease inhibitor Kazal-type 1 Pancreatic secretory trypsin inhibitor Tumor-associated trypsin inhibitor TATI |
| Gene Name | SPINK1 PSTI |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MKVTGIFLLSALALLSLSGNTGADSLGREAKCYNELNGCTKIYDPVCGTDGNTYPNECVLCFENRKRQTSILIQKSGPC |
| Enzyme Length | 79 |
| Uniprot Accession Number | P00995 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor which exhibits anti-trypsin activity (PubMed:7142173). In the pancreas, protects against trypsin-catalyzed premature activation of zymogens (By similarity). {ECO:0000250|UniProtKB:P09036, ECO:0000269|PubMed:7142173}.; FUNCTION: In the male reproductive tract, binds to sperm heads where it modulates sperm capacitance by inhibiting calcium uptake and nitrogen oxide (NO) production. {ECO:0000250|UniProtKB:P09036}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (5); Chain (1); Disulfide bond (3); Domain (1); Helix (1); Natural variant (5); Sequence conflict (4); Signal peptide (1); Site (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disease variant;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
| Interact With | Q12797-6 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:7142173}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23; /evidence="ECO:0000269|PubMed:7142173, ECO:0000269|PubMed:843082" |
| Structure 3D | X-ray crystallography (3) |
| Cross Reference PDB | 1CGI; 1CGJ; 1HPT; |
| Mapped Pubmed ID | 11866271; 11938439; 11950815; 11950817; 12014716; 12120220; 12120224; 12360463; 12360464; 12452372; 12529713; 12649567; 12822871; 12825076; 12875970; 12939655; 12973686; 14507909; 14526128; 14595541; 14675563; 14688470; 14722925; 15082592; 15238770; 15329520; 15367892; 15749232; 15749233; 15753612; 15764155; 15782101; 15810949; 15910626; 15980664; 15987793; 16187186; 16327984; 16497624; 16764792; 16954950; 16958672; 16981266; 17003641; 17072959; 17163998; 17238043; 17333166; 17446841; 17489851; 17525091; 17568390; 17613931; 17681820; 17981921; 17990360; 18076731; 18182741; 18317448; 18336671; 18347987; 18414673; 18428024; 18538735; 18580441; 18680227; 1870127; 18706099; 18852684; 18953248; 18978175; 18986377; 19077465; 19096130; 19147803; 19372376; 19384300; 19404200; 19433603; 19465903; 19502653; 19565042; 19578796; 19593166; 19654461; 19657220; 19696993; 19844201; 19845895; 19864383; 20108119; 20502448; 20543535; 20551465; 20625975; 20676769; 20849596; 20977904; 21323990; 21368222; 21375584; 21415673; 21610753; 21656687; 21739120; 21792085; 21864386; 21952138; 22041280; 22042864; 22094894; 22228370; 22313860; 22343981; 22363992; 22427236; 22508321; 22526274; 22699143; 22751291; 22944196; 22955423; 23017645; 23348902; 23459095; 23475261; 23527199; 23751316; 23843146; 23951356; 24075519; 24134754; 24204699; 24254562; 24583226; 24654459; 24687926; 24844923; 25003218; 25206283; 25383785; 25531719; 25639219; 25667483; 25792561; 25804623; 25835118; 25862856; 25981744; 26037168; 26054682; 26100556; 26124326; 26172920; 26348468; 26350184; 26376395; 26437224; 26632706; 26658045; 26692446; 26725250; 26743468; 27159572; 27238617; 27358244; 27409067; 27578509; 27738792; 28229614; 28472998; 28546062; 28556356; 28609377; 28631187; 28845526; 28861620; 28945313; 29346218; 29525377; 29641165; 29682763; 30051483; 30333494; 30545439; 30747826; 30755276; 30850708; 31401021; 31478211; 31525466; 31584209; 31594208; 31759918; 31911942; 31959826; 32011822; 32282761; 32929152; 32948427; 33097431; 33491427; 33512798; 33515547; 34140232; 34794144; |
| Motif | |
| Gene Encoded By | |
| Mass | 8,507 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |