IED ID | IndEnz0002010368 |
Enzyme Type ID | protease010368 |
Protein Name |
Penicillin-insensitive murein endopeptidase EC 3.4.24.- D-alanyl-D-alanine-endopeptidase DD-endopeptidase |
Gene Name | mepA EC55989_2572 |
Organism | Escherichia coli (strain 55989 / EAEC) |
Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain 55989 / EAEC) |
Enzyme Sequence | MNKTAIALLALLASSASLAATPWQKITQPVPGSAQSIGSFSNGCIVGADTLPIQSEHYQVMRTDQRRYFGHPDLVMFIQRLSSQVSNLGMGTVLIGDMGMPAGGRFNGGHASHQTGLDVDIFLQLPKTRWTSAQLLRPQALDLVSRDGKHVVSTLWKPEIFSLIKLAAQDKDVTRIFVNPAIKQQLCLDAGTDRDWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPPGDGCGAELQSWFAPPKPGTTKPEKKTPSPLPPSCQALLDEHVI |
Enzyme Length | 274 |
Uniprot Accession Number | B7LBI2 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | 3.4.24.- |
Enzyme Function | FUNCTION: Murein endopeptidase that cleaves the D-alanyl-meso-2,6-diamino-pimelyl amide bond that connects peptidoglycan strands. Likely plays a role in the removal of murein from the sacculus. {ECO:0000255|HAMAP-Rule:MF_01623}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (3); Metal binding (6); Region (1); Signal peptide (1) |
Keywords | Disulfide bond;Hydrolase;Metal-binding;Metalloprotease;Periplasm;Protease;Signal;Zinc |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Periplasm {ECO:0000255|HAMAP-Rule:MF_01623}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..19; /evidence=ECO:0000255|HAMAP-Rule:MF_01623 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 30,079 |
Kinetics | |
Metal Binding | METAL 110; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 113; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 120; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 147; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 150; /note=Zinc 2; /evidence=ECO:0000255|HAMAP-Rule:MF_01623; METAL 211; /note=Zinc 1; /evidence=ECO:0000255|HAMAP-Rule:MF_01623 |
Rhea ID | |
Cross Reference Brenda |