| IED ID | IndEnz0002010396 |
| Enzyme Type ID | protease010396 |
| Protein Name |
Protease PrsW EC 3.4.-.- Protease responsible for activating sigma-W |
| Gene Name | prsW GK2232 |
| Organism | Geobacillus kaustophilus (strain HTA426) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Geobacillus Geobacillus thermoleovorans group Geobacillus kaustophilus Geobacillus kaustophilus (strain HTA426) |
| Enzyme Sequence | MFSLISAGVAPGVALLSYFYLKDEYEAEPLSFVLRMFLFGVLLVFPIMFIQYVLAAEGIVASPAAEAFLSAALLEEFVKWFVVYFFVYDHDEFDEPYDGIVYSASVSLGFATLENILYLLANGVETAIARALLPVSSHALFSVIMGFYFGKAKFAVKKRRYYLWASFLLPFFLHGVYDWLLLAKERWGYYMGLFMLALWWAALRKVKQAKGYARPQAVPPVKSQA |
| Enzyme Length | 225 |
| Uniprot Accession Number | Q5KXR9 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.-.- |
| Enzyme Function | FUNCTION: Involved in the degradation of specific anti-sigma factors. Responsible for Site-1 cleavage of the RsiW anti-sigma factor. This results, after two other proteolytic steps catalyzed by the RasP and ClpXP proteases, in the release of SigW and the transcription activation of the genes under the control of the sigma-W factor (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous initiation (1); Topological domain (5); Transmembrane (5) |
| Keywords | Cell membrane;Hydrolase;Membrane;Protease;Reference proteome;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell membrane {ECO:0000305}; Multi-pass membrane protein {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 25,541 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |