| IED ID | IndEnz0002010397 |
| Enzyme Type ID | protease010397 |
| Protein Name |
Proteasome subunit alpha type-3 20S proteasome alpha subunit G-1 DiDi 17A-2a Proteasome component 8 Proteasome subunit alpha type-7 |
| Gene Name | PAG1 PRC8 At2g27020 T20P8.7 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSSIGTGYDLSVTTFSPDGRVFQIEYAAKAVDNSGTVVGIKCKDGIVMGVEKLIASKMMLPGSNRRIHSVHRHAGMAVAGLAADGRQIVARAKSEARSYESVYGDAVPVKELSERVASYVHLCTLYWWLRPFGCGVILGGYDRDGPQLYMIEPSGISYRYFGAAIGKGKQAAKTEIEKLNLSEMTCKEGVIEVAKIIYKLHDEAKDKAFELEMSWICEESKREHQKVPDDLLEEAKTAAKTALEEMDAD |
| Enzyme Length | 249 |
| Uniprot Accession Number | O23715 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Cross-link (1); Initiator methionine (1); Modified residue (3); Sequence conflict (1) |
| Keywords | Acetylation;Cytoplasm;Isopeptide bond;Nucleus;Proteasome;Reference proteome;Ubl conjugation |
| Interact With | O23160 |
| Induction | INDUCTION: Induced by the endoparasitic nematode M.incognita. Levels increase after infection in both giants cells and endodermal cells of galls. Later confined to giant cells at high levels. {ECO:0000269|PubMed:11277426}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. |
| Modified Residue | MOD_RES 2; /note=N-acetylserine; /evidence=ECO:0007744|PubMed:22223895; MOD_RES 214; /note=O-acetylserine; /evidence=ECO:0000269|PubMed:20516081; MOD_RES 220; /note=O-acetylserine; /evidence=ECO:0000269|PubMed:20516081 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12952558; 14500793; 14617066; 15215502; 16055689; 16502469; 17151019; 17675552; 17825468; 18538804; 18805951; 20118269; 20405473; 28627464; |
| Motif | |
| Gene Encoded By | |
| Mass | 27,377 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |