| IED ID | IndEnz0002010398 |
| Enzyme Type ID | protease010398 |
| Protein Name |
Streptogrisin-A EC 3.4.21.80 Pronase enzyme A SGPA Serine protease A |
| Gene Name | sprA |
| Organism | Streptomyces griseus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Streptomycetales Streptomycetaceae Streptomyces Streptomyces griseus group Streptomyces griseus subgroup Streptomyces griseus |
| Enzyme Sequence | MTFKRFSPLSSTSRYARLLAVASGLVAAAALATPSAVAAPEAESKATVSQLADASSAILAADVAGTAWYTEASTGKIVLTADSTVSKAELAKVSNALAGSKAKLTVKRAEGKFTPLIAGGEAITTGGSRCSLGFNVSVNGVAHALTAGHCTNISASWSIGTRTGTSFPNNDYGIIRHSNPAAADGRVYLYNGSYQDITTAGNAFVGQAVQRSGSTTGLRSGSVTGLNATVNYGSSGIVYGMIQTNVCAEPGDSGGSLFAGSTALGLTSGGSGNCRTGGTTFYQPVTEALSAYGATVL |
| Enzyme Length | 297 |
| Uniprot Accession Number | P00776 |
| Absorption | |
| Active Site | ACT_SITE 149; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 171; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 253; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Hydrolysis of proteins with specificity similar to chymotrypsin.; EC=3.4.21.80; |
| DNA Binding | |
| EC Number | 3.4.21.80 |
| Enzyme Function | FUNCTION: Has a primary specificity for large aliphatic or aromatic amino acids. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (18); Chain (1); Disulfide bond (2); Helix (4); Propeptide (1); Sequence conflict (2); Signal peptide (1); Turn (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Serine protease;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..38 |
| Structure 3D | X-ray crystallography (5) |
| Cross Reference PDB | 1SGC; 2SGA; 3SGA; 4SGA; 5SGA; |
| Mapped Pubmed ID | 3892015; 3892018; 6783761; |
| Motif | |
| Gene Encoded By | |
| Mass | 29,663 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |