| IED ID | IndEnz0002010407 |
| Enzyme Type ID | protease010407 |
| Protein Name |
Probable 26S proteasome non-ATPase regulatory subunit 3 26S proteasome subunit S3 26S proteasome regulatory subunit RPN3 Nuclear antigen 21D7 |
| Gene Name | 21D7 |
| Organism | Nicotiana tabacum (Common tobacco) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae asterids lamiids Solanales Solanaceae Nicotianoideae Nicotianeae Nicotiana Nicotiana tabacum (Common tobacco) |
| Enzyme Sequence | MTQDVEMKEQAAPPSNSLSSTAPSIFHHLKEIASLIETGAYAREVRRISRAVRLTMALRKKLKASSLSAFLNYVLVPGSEVHSRLSSFLPKEDEQDMEVDTATSGAQAPIKNPLPELEIYCYLLVLIFLIDQKKYNEAKACSSASIARLKTVNRRTVDVLASRLYFYYSLCYELTGDLAEIRGYLLALHRIATLRHDELGQETLLNLLLRNYLHYNLYDQAEKLRSKAPRFEAHSNQQFSRYLFYLGKIRTIQLEYTDAKESLLQAARKAPQAALGFRVQCNKWAIIVRLLLGEIPERTVFMQKGMEKALRPYFELTNAVRIGDLELFRKVAEKFSSTFSSDGTNNLIVRLRHNVIRTGLRNISISYSRISLVDVAKKLRLDSPNPVADAESIVSKAIRDGAIDATLDHANGWMVSKETGDIYSTNEPQIAFNSRIAFCLNMHNEAVRALRFPPNSHKEKESAEKRRERQQQEQELAKHIAEEDDDDF |
| Enzyme Length | 488 |
| Uniprot Accession Number | P93768 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins. {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Compositional bias (1); Domain (1); Region (2) |
| Keywords | Nucleus;Proteasome;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Nucleus. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 12609025; |
| Motif | |
| Gene Encoded By | |
| Mass | 55,577 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |