| IED ID | IndEnz0002010414 | 
| Enzyme Type ID | protease010414 | 
| Protein Name | Proteasome subunit alpha 20S proteasome alpha subunit Proteasome core protein PrcA | 
| Gene Name | prcA FRAAL2874 | 
| Organism | Frankia alni (strain ACN14a) | 
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Actinobacteria Actinomycetia (high G+C Gram-positive bacteria) Frankiales Frankiaceae Frankia Frankia alni Frankia alni (strain ACN14a) | 
| Enzyme Sequence | MTMPFGYASPEQQVRDKSEYARKGIARGRSVVVITYADGILFVAENPSATLHKISEIYDRIAFAAVGKYNEFENLRTAGIRLMDSRGYMYDRRDVTSRALANAYAQTLGAIFTESVKPYEVEIVVAEVGPTTDDDQIYKLTFDGSIADERGFVAIGGASDQVTTSLKEHHRDGQPLADALRVAVQALTVSVPPGLPQNGERVLTAANLEVGMLDRTRARRQFKRIAGPALAELLAQTATSS | 
| Enzyme Length | 241 | 
| Uniprot Accession Number | Q0RLT6 | 
| Absorption | |
| Active Site | |
| Activity Regulation | ACTIVITY REGULATION: The formation of the proteasomal ATPase ARC-20S proteasome complex, likely via the docking of the C-termini of ARC into the intersubunit pockets in the alpha-rings, may trigger opening of the gate for substrate entry. Interconversion between the open-gate and close-gate conformations leads to a dynamic regulation of the 20S proteasome proteolysis activity. {ECO:0000255|HAMAP-Rule:MF_00289}. | 
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Component of the proteasome core, a large protease complex with broad specificity involved in protein degradation. {ECO:0000255|HAMAP-Rule:MF_00289}. | 
| Temperature Dependency | |
| PH Dependency | |
| Pathway | PATHWAY: Protein degradation; proteasomal Pup-dependent pathway. {ECO:0000255|HAMAP-Rule:MF_00289}. | 
| nucleotide Binding | |
| Features | Chain (1) | 
| Keywords | Cytoplasm;Proteasome;Reference proteome | 
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000255|HAMAP-Rule:MF_00289}. | 
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - | 
| Mapped Pubmed ID | - | 
| Motif | |
| Gene Encoded By | |
| Mass | 26,303 | 
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |