| IED ID | IndEnz0002010420 |
| Enzyme Type ID | protease010420 |
| Protein Name |
Ribonuclease-like 3 RNase ZF-3 RNase-like 3 ZF-RNase-3 EC 3.1.27.- Dr-RNase 1 Cleaved into: N-terminal peptide; LF-ZF3 |
| Gene Name | rnasel3 |
| Organism | Danio rerio (Zebrafish) (Brachydanio rerio) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Actinopterygii Actinopteri Neopterygii Teleostei Osteoglossocephalai Clupeocephala Otomorpha Ostariophysi Otophysi Cypriniphysae Cypriniformes (carps and others) Cyprinoidei Danionidae Danioninae Danio Danio rerio (Zebrafish) (Brachydanio rerio) |
| Enzyme Sequence | MGIHQCTAVVLLLLCASLSTYGQPAEIRRRYEHFLTQHVYGGITEQTCDRVMRQRRITRFPTGNDCKEVNTFIQANGNHVRTVCTGGGTRQTDNRDLYMSNNQFTVITCTLRSGERHPNCRYRGKESSRKIVVACEGEWPTHYEKGVIV |
| Enzyme Length | 149 |
| Uniprot Accession Number | A5HAK0 |
| Absorption | |
| Active Site | ACT_SITE 38; /note=Proton acceptor; /evidence=ECO:0000269|PubMed:18508078; ACT_SITE 142; /note=Proton donor; /evidence=ECO:0000269|PubMed:18508078 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.27.- |
| Enzyme Function | FUNCTION: Ribonuclease. Angiogenic. Plays a role in host defense. Exhibits strong antibacterial activity against Gram-negative bacteria but mild antibacterial activity against Gram-positive bacteria. The RNase activity is not required for the bactericidal activity. {ECO:0000269|PubMed:16861230, ECO:0000269|PubMed:17347156, ECO:0000269|PubMed:18508078, ECO:0000269|PubMed:20214681}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Beta strand (8); Chain (1); Disulfide bond (3); Helix (4); Modified residue (1); Natural variant (7); Peptide (2); Region (1); Sequence conflict (1); Signal peptide (1); Site (1) |
| Keywords | 3D-structure;Angiogenesis;Antibiotic;Antimicrobial;Developmental protein;Differentiation;Direct protein sequencing;Disulfide bond;Endonuclease;Hydrolase;Immunity;Nuclease;Pyrrolidone carboxylic acid;Reference proteome;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000250|UniProtKB:P34096}. |
| Modified Residue | MOD_RES 23; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000250|UniProtKB:P34096 |
| Post Translational Modification | PTM: Cleavage between Arg-55 and Arg-56 is catalyzed by a membrane-localized Gram-negative bacterium protease (OmpT in E.coli). The excised fragment is then transported to the bacterium cytosol for cleavage of the disulfide bridge linking Cys-48 and Cys-109, thus separating the N-terminal and LF-ZF3. LF-ZF3 but not the N-terminal peptide possesses bactericidal activity. {ECO:0000269|PubMed:20214681}. |
| Signal Peptide | SIGNAL 1..22; /evidence=ECO:0000269|PubMed:18508078 |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 2VQ9; |
| Mapped Pubmed ID | 18852033; 21050179; |
| Motif | |
| Gene Encoded By | |
| Mass | 17,011 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 4.6.1.18; |