| IED ID | IndEnz0002010579 |
| Enzyme Type ID | protease010579 |
| Protein Name |
Putative peptidase PfaP EC 3.4.21.- PF-associated peptidase Periplasmic flagella-associated protein |
| Gene Name | pfaP |
| Organism | Leptospira borgpetersenii |
| Taxonomic Lineage | cellular organisms Bacteria Spirochaetes Spirochaetia Leptospirales Leptospiraceae Leptospira Leptospira borgpetersenii |
| Enzyme Sequence | MRLRKTRKIVVSMKDMAASGGYYIASSADKIFALSGTITGSIGVLQWLRYQRAFGSLGVKMRTYKEGKYKDSLSLFRDSTPEEDEMIQKMLSDTYNEFVQDVAKGRNQTVKSVQNLAEGRIYSGQDAFRNKLVDEIGGRKEALEELSRLCQYDGEIPLYEEEESPFDRLFMMLGSKMNSFSSERIFFREFKNSPVLVILPQAIR |
| Enzyme Length | 204 |
| Uniprot Accession Number | Q48513 |
| Absorption | |
| Active Site | ACT_SITE 19; /note=Nucleophile; /evidence=ECO:0000250; ACT_SITE 70; /note=Proton donor/acceptor; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Possible protease. May be involved in export of periplasmic flagella proteins. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Signal peptide (1) |
| Keywords | Hydrolase;Protease;Serine protease;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 23,354 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |