| IED ID | IndEnz0002010585 |
| Enzyme Type ID | protease010585 |
| Protein Name |
Gamma-DL-glutamyl hydrolase EC 3.4.19.- Poly-gamma-glutamate depolymerase PGA depolymerase |
| Gene Name | pgdS ywtD BSU35860 |
| Organism | Bacillus subtilis (strain 168) |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Bacillaceae Bacillus Bacillus subtilis group Bacillus subtilis Bacillus subtilis subsp. subtilis Bacillus subtilis (strain 168) |
| Enzyme Sequence | MNTLANWKKFLLVAVIICFLVPIMTKAEIAEADTSSELIVSEAKNLLGYQYKYGGETPKEGFDPSGLIQYVFSKADIHLPRSVNDQYKIGTAVKPENLKPGDILFFKKEGSTGTVPTHDALYIGDGQMVHSTQSKGVIITNYKKSSYWSGTYIGARRIAADPATADVPVVQEAEKYIGVPYVFGGSTPSEGFDCSGLVQYVFQQALGIYLPRSAEQQWAVGEKVAPQNIKPGDVVYFSNTYKTGISHAGIYAGAGRFIQASRSEKVTISYLSEDYWKSKMTGIRRFDNLTIPKENPIVSEATLYVGEVPYKQGGVTPETGFDTAGFVQYVYQKAAGISLPRYATSQYNAGTKIEKADLKPGDIVFFQSTSLNPSIYIGNGQVVHVTLSNGVTITNMNTSTYWKDKYAGSIRVQ |
| Enzyme Length | 413 |
| Uniprot Accession Number | P96740 |
| Absorption | |
| Active Site | ACT_SITE 194; /note=Nucleophile; /evidence=ECO:0000255|PROSITE-ProRule:PRU01284; ACT_SITE 247; /note=Proton acceptor; /evidence=ECO:0000255|PROSITE-ProRule:PRU01284; ACT_SITE 259; /evidence=ECO:0000255|PROSITE-ProRule:PRU01284 |
| Activity Regulation | ACTIVITY REGULATION: Inhibited by pretreatment with 1 mM 4-(hydroxymercuri)benzoate, a sulfhydryl inhibitor. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.19.- |
| Enzyme Function | FUNCTION: Cleaves, in an endo-type manner, the gamma-glutamyl bond between D-glutamate and L-glutamate of poly-gamma-glutamate (PGA). |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Optimum temperature is 45 degrees Celsius.; |
| PH Dependency | BIOPHYSICOCHEMICAL PROPERTIES: pH dependence: Optimum pH is 5.0.; |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Domain (3); Natural variant (3); Signal peptide (1) |
| Keywords | Cell wall;Direct protein sequencing;Hydrolase;Protease;Reference proteome;Secreted;Signal;Thiol protease |
| Interact With | |
| Induction | INDUCTION: In stationary phase; under control of SigD. {ECO:0000269|PubMed:11987133}. |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. Secreted, cell wall. Note=Cell wall localization shown in PubMed:11987133. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..32; /evidence=ECO:0000269|PubMed:10658653 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 45,247 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |