| IED ID | IndEnz0002010599 |
| Enzyme Type ID | protease010599 |
| Protein Name |
Lysosomal protective protein EC 3.4.16.5 Carboxypeptidase C Carboxypeptidase L Cathepsin A Protective protein cathepsin A PPCA Protective protein for beta-galactosidase Cleaved into: Lysosomal protective protein 32 kDa chain; Lysosomal protective protein 20 kDa chain |
| Gene Name | Ctsa Ppgb |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MPGTALSPLLLLLLLSWASRNEAAPDQDEIDCLPGLAKQPSFRQYSGYLRASDSKHFHYWFVESQNDPKNSPVVLWLNGGPGCSSLDGLLTEHGPFLIQPDGVTLEYNPYAWNLIANVLYIESPAGVGFSYSDDKMYVTNDTEVAENNYEALKDFFRLFPEYKDNKLFLTGESYAGIYIPTLAVLVMQDPSMNLQGLAVGNGLASYEQNDNSLVYFAYYHGLLGNRLWTSLQTHCCAQNKCNFYDNKDPECVNNLLEVSRIVGKSGLNIYNLYAPCAGGVPGRHRYEDTLVVQDFGNIFTRLPLKRRFPEALMRSGDKVRLDPPCTNTTAPSNYLNNPYVRKALHIPESLPRWDMCNFLVNLQYRRLYQSMNSQYLKLLSSQKYQILLYNGDVDMACNFMGDEWFVDSLNQKMEVQRRPWLVDYGESGEQVAGFVKECSHITFLTIKGAGHMVPTDKPRAAFTMFSRFLNKEPY |
| Enzyme Length | 474 |
| Uniprot Accession Number | P16675 |
| Absorption | |
| Active Site | ACT_SITE 173; /evidence=ECO:0000250; ACT_SITE 394; /evidence=ECO:0000250; ACT_SITE 451; /evidence=ECO:0000250 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Release of a C-terminal amino acid with broad specificity.; EC=3.4.16.5; Evidence={ECO:0000255|PROSITE-ProRule:PRU10074, ECO:0000255|PROSITE-ProRule:PRU10075}; |
| DNA Binding | |
| EC Number | 3.4.16.5 |
| Enzyme Function | FUNCTION: Protective protein appears to be essential for both the activity of beta-galactosidase and neuraminidase, it associates with these enzymes and exerts a protective function necessary for their stability and activity. This protein is also a carboxypeptidase and can deamidate tachykinins. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (3); Disulfide bond (4); Glycosylation (2); Sequence conflict (1); Signal peptide (1) |
| Keywords | 3D-structure;Carboxypeptidase;Disulfide bond;Glycoprotein;Hydrolase;Lysosome;Protease;Reference proteome;Signal;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Lysosome. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..23 |
| Structure 3D | Electron microscopy (1) |
| Cross Reference PDB | 7KDV; |
| Mapped Pubmed ID | 10725249; 11217851; 12023988; 12466851; 12505983; 12520002; 12548663; 14579412; 14610273; 14651853; 14681479; 14960280; 15084520; 16141072; 17522420; 18391110; 18799693; 19066718; 19666471; 19714866; 19889639; 2025648; 20388541; 23495688; 23520133; 24357053; 24586188; 28234994; 3136930; 32529664; 32647007; 33980489; 7590240; 7959780; 9174165; 9425240; 9736781; |
| Motif | |
| Gene Encoded By | |
| Mass | 53,844 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda | 3.4.16.5; |