| IED ID | IndEnz0002010607 |
| Enzyme Type ID | protease010607 |
| Protein Name |
Kunitz-type conkunitzin-B1 Conk-B1 |
| Gene Name | |
| Organism | Conus bullatus (Bubble cone) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Spiralia Lophotrochozoa Mollusca Gastropoda Caenogastropoda Neogastropoda Conoidea Conidae (cone shells) Conus Textilia Conus bullatus (Bubble cone) |
| Enzyme Sequence | MEGRRFAAVLILPICMLAPGAVASKRWTRPSVCNLPAESGTGTQSLKRFYYNSDKMQCRTFIYKGNGGNDNNFPRTYDCQKKCLYRPG |
| Enzyme Length | 88 |
| Uniprot Accession Number | P0CY85 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Blocks specifically voltage-activated potassium channels (Kv) of the Shaker family. {ECO:0000250|UniProtKB:P0C1X2}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (2); Domain (1); Modified residue (1); Signal peptide (1) |
| Keywords | Amidation;Disulfide bond;Ion channel impairing toxin;Neurotoxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:21266071}. |
| Modified Residue | MOD_RES 87; /note=Proline amide; /evidence=ECO:0000250 |
| Post Translational Modification | PTM: Contains 2 disulfide bonds instead of 3, as for all Kunitz domain proteins. |
| Signal Peptide | SIGNAL 1..23; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,931 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |