IED ID | IndEnz0002010614 |
Enzyme Type ID | protease010614 |
Protein Name |
WAP four-disulfide core domain protein 1 Prostate stromal protein ps20 ps20 growth inhibitor |
Gene Name | Wfdc1 Ps20 |
Organism | Rattus norvegicus (Rat) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Rattus Rattus norvegicus (Rat) |
Enzyme Sequence | MGSCDRKALWALSFLLLLLGSSSVQGTWEAMLPVRLAEKSQAEEVAATGSRQPHADRCPPPPRTLPPGACQATRCQSDSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQPKPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILQPGDAAQGIPNHGRCVKQRRQAEGRVLRQKLHKEYPEGDSKYVAEPGKGQQRHFP |
Enzyme Length | 212 |
Uniprot Accession Number | O70280 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Has growth inhibitory activity. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (4); Domain (1); Region (2); Signal peptide (1) |
Keywords | Direct protein sequencing;Disulfide bond;Protease inhibitor;Reference proteome;Secreted;Serine protease inhibitor;Signal |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..26; /evidence=ECO:0000269|PubMed:7665628 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | 15677758; |
Motif | |
Gene Encoded By | |
Mass | 23,230 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |