| IED ID | IndEnz0002010623 |
| Enzyme Type ID | protease010623 |
| Protein Name |
Zinc metalloproteinase/disintegrin Cleaved into: Snake venom metalloproteinase brevilysin L4 SVMP Snake venom metalloproteinase hxl-1 EC 3.4.24.- ; Disintegrin brevicaudin-1a; Disintegrin brevicaudin-1b Disintegrin adinbitor Disintegrin halystatin Fragment |
| Gene Name | |
| Organism | Gloydius brevicaudus (Korean slamosa snake) (Agkistrodon halys brevicaudus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Gloydius Gloydius brevicaudus (Korean slamosa snake) (Agkistrodon halys brevicaudus) |
| Enzyme Sequence | EDEAPKMCGVTQNWESYEPIKKASQSNLTPAHQRYIELVIVADHGMFTKYNGDSDKIREWVRQMVNTVDEIYSYMYIDVALAGLEIWSNEDLINVQPAAPHTLDSFGKWRERDLLHRIHHDNAMLLTAIDFDGPTIGLAYVGTMCKPKGSTGVVQDHSTINLRVAVTMAHEIGHNLGIHHDTGSCSCGGYSCIMSPVISHEPSKYFSDCSYTQCWDFIMNQKPQCILNKPLRTDTVSTPVSGNELLEAGEECDCGSPGNPCCDAATCKLRQGAQCAEGLCCDQCRFMKKGTVCRIARGDDMDDYCNGISAGCPRNPFHA |
| Enzyme Length | 319 |
| Uniprot Accession Number | Q698K8 |
| Absorption | |
| Active Site | ACT_SITE 171; /evidence="ECO:0000255|PROSITE-ProRule:PRU00276, ECO:0000255|PROSITE-ProRule:PRU10095" |
| Activity Regulation | ACTIVITY REGULATION: Excess of calcium ions significantly suppress the autoproteolysis of the enzyme. {ECO:0000269|PubMed:15188058}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.24.- |
| Enzyme Function | FUNCTION: [Snake venom metalloproteinase brevilysin L4]: metalloproteinase that impairs hemostasis in the envenomed animal (By similarity). Shows autoproteolysis dependent on pH and temperature. Does not show hemorrhagic activity. {ECO:0000250, ECO:0000269|PubMed:15188058, ECO:0000269|Ref.3}.; FUNCTION: [Disintegrin brevicaudin-1a]: Inhibits platelet aggregation induced by ADP (IC(50) is 200 nM), collagen (IC(50) is 500 nM), thrombin and epinephrin (IC(50) is 300 nM). Does not inhibit aggregation induced by ristocetin.; FUNCTION: [Disintegrin brevicaudin-1b]: Inhibits platelet aggregation induced by ADP (IC(50) is 100 nM), collagen (IC(50) is 500 nM), thrombin and epinephrin (IC(50) is 300 nM). Does not inhibit aggregation induced by ristocetin. Significantly inhibits angiogenesis both in vivo and in vitro. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (3); Disulfide bond (9); Domain (2); Erroneous termination (1); Metal binding (7); Motif (1); Non-terminal residue (1); Propeptide (2); Sequence conflict (1) |
| Keywords | Calcium;Cell adhesion impairing toxin;Direct protein sequencing;Disulfide bond;Hemostasis impairing toxin;Hydrolase;Metal-binding;Metalloprotease;Platelet aggregation inhibiting toxin;Protease;Secreted;Toxin;Zinc;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | MOTIF 297..299; /note=Cell attachment site |
| Gene Encoded By | |
| Mass | 35,314 |
| Kinetics | |
| Metal Binding | METAL 37; /note=Calcium; /evidence=ECO:0000250; METAL 121; /note=Calcium; /evidence=ECO:0000250; METAL 170; /note=Zinc; catalytic; /evidence=ECO:0000250; METAL 174; /note=Zinc; catalytic; /evidence=ECO:0000250; METAL 180; /note=Zinc; catalytic; /evidence=ECO:0000250; METAL 225; /note=Calcium; via carbonyl oxygen; /evidence=ECO:0000250; METAL 228; /note=Calcium; /evidence=ECO:0000250 |
| Rhea ID | |
| Cross Reference Brenda |