| IED ID | IndEnz0002010628 |
| Enzyme Type ID | protease010628 |
| Protein Name |
Kunitz-type serine protease inhibitor IX Bungarus fasciatus fraction IX BF9 Venom basic protease inhibitor IX Cleaved into: Kunitz-type serine protease inhibitor VIIIB Venom basic protease inhibitor VIIIB |
| Gene Name | |
| Organism | Bungarus fasciatus (Banded krait) (Pseudoboa fasciata) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Bungarinae Bungarus Bungarus fasciatus (Banded krait) (Pseudoboa fasciata) |
| Enzyme Sequence | KNRPTFCNLLPETGRCNALIPAFYYNSHLHKCQKFNYGGCGGNANNFKTIDECQRTCAAKYGRSS |
| Enzyme Length | 65 |
| Uniprot Accession Number | P25660 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Dual-function toxin that inhibits both serine proteases (high activity on chymotrypsin (Ki = 18 nM), and low activity on elastase) and voltage-gated potassium channels Kv1.3/KCNA3 (IC(50) = 120.0 nM). {ECO:0000269|PubMed:11562364, ECO:0000269|PubMed:24243656}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (3); Chain (2); Disulfide bond (3); Domain (1); Helix (2); Mutagenesis (3); Site (1); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Secreted;Serine protease inhibitor;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 1JC6; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,294 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |