| IED ID | IndEnz0002010631 |
| Enzyme Type ID | protease010631 |
| Protein Name |
Kunitz-type serine protease inhibitor PPTI Pseudocerastes persicus trypsin inhibitor PPTI |
| Gene Name | |
| Organism | Pseudocerastes persicus (Persian horned viper) (False horned viper) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Viperinae (vipers) Pseudocerastes Pseudocerastes persicus (Persian horned viper) (False horned viper) |
| Enzyme Sequence | EDRPKFCYLPDDPGVCKAHIPRFYYNPASNKCKEFIYGGCGGNANNFETRAECRHTCVASRKGGPRRP |
| Enzyme Length | 68 |
| Uniprot Accession Number | C0HLB2 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor that weakly inhibits trypsin (Ki=0.2 uM) (PubMed:30452896). May have potassium channel blocking activities (PubMed:30973886). {ECO:0000269|PubMed:30452896, ECO:0000305|PubMed:30973886}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (2); Chain (1); Disulfide bond (3); Domain (1); Helix (3); Modified residue (1); Site (2) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Potassium channel impairing toxin;Protease inhibitor;Pyrrolidone carboxylic acid;Secreted;Serine protease inhibitor;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:30452896}. |
| Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid (Glu); /evidence=ECO:0000269|PubMed:30452896 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1) |
| Cross Reference PDB | 6A5I; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,668 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |