Detail Information for IndEnz0002010680
IED ID IndEnz0002010680
Enzyme Type ID protease010680
Protein Name Protease I
Gene product 32
gp32
Gene product I
gpI
Gene Name I Z Mup32 Mup33
Organism Escherichia phage Mu (Bacteriophage Mu)
Taxonomic Lineage Viruses Duplodnaviria Heunggongvirae Uroviricota Caudoviricetes Caudovirales Myoviridae (phages with contractile tails) Muvirus Escherichia phage Mu (Bacteriophage Mu)
Enzyme Sequence MKKHAIGIAALNALSIDDDGWCQLLPAGHFSARDGRPFDVTGGQGWFIDGEIAGRLVEGVRALNQDVLIDYEHNQLRKDKGLPPEQLVAAGWFNADEMQWREGEGLFIHPRWTAAAQQRIDDGEFGYLSAVFPYDTATGAVLQIRLAALTNDPGATGMKKLTALAADLPDILQQENKPMNETLRKLLARLGVTVPENADITDEQATAALTALDTLEINAGKVAALSAELEKAQKAAVDLTKYVPVESYNALRDELAQATAQSATASLSAVLDKAEQEGRIFKSERTYLEQLGGQIGVAALSAQLEKKQPIAALSAMQTTTAKIPSQEKTAVAVLSADEQAAVKALGITEAEYLKMKQEQEK
Enzyme Length 361
Uniprot Accession Number Q01267
Absorption
Active Site
Activity Regulation
Binding Site
Calcium Binding
catalytic Activity
DNA Binding
EC Number
Enzyme Function FUNCTION: Protease I is involved in virion assembly and maturation. Protease I cleaves the portal protein to yield mature procapsids competent for DNA packaging (Probable). Isoform scaffold protein Z probably helps the capsid proteins to assemble into a functional capsid (Probable). {ECO:0000305|PubMed:11922669, ECO:0000305|PubMed:8599204, ECO:0000305|PubMed:9495752}.
Temperature Dependency
PH Dependency
Pathway
nucleotide Binding
Features Alternative sequence (1); Chain (1)
Keywords Acetylation;Alternative initiation;Direct protein sequencing;Host cytoplasm;Hydrolase;Late protein;Protease;Reference proteome;Viral capsid assembly;Viral capsid maturation;Viral release from host cell
Interact With
Induction INDUCTION: Expressed in the late phase of the viral replicative cycle. Expression of late genes is activated by the viral late transcription activator C. {ECO:0000269|PubMed:8293968}.
Subcellular Location SUBCELLULAR LOCATION: Host cytoplasm {ECO:0000305}.
Modified Residue
Post Translational Modification PTM: The N-terminus is acetylated. {ECO:0000305}.
Signal Peptide
Structure 3D
Cross Reference PDB -
Mapped Pubmed ID -
Motif
Gene Encoded By
Mass 38,893
Kinetics
Metal Binding
Rhea ID
Cross Reference Brenda