| IED ID | IndEnz0002010726 |
| Enzyme Type ID | protease010726 |
| Protein Name |
Small ubiquitin-related modifier 3 SUMO-3 SMT3 homolog 1 SUMO-2 Ubiquitin-like protein SMT3A Smt3A |
| Gene Name | SUMO3 SMT3A SMT3H1 |
| Organism | Homo sapiens (Human) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Primates Haplorrhini Simiiformes Catarrhini Hominoidea (apes) Hominidae (great apes) Homininae Homo Homo sapiens (Human) |
| Enzyme Sequence | MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF |
| Enzyme Length | 103 |
| Uniprot Accession Number | P55854 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Ubiquitin-like protein which can be covalently attached to target lysines either as a monomer or as a lysine-linked polymer. Does not seem to be involved in protein degradation and may function as an antagonist of ubiquitin in the degradation process. Plays a role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Covalent attachment to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4 (PubMed:11451954, PubMed:18538659, PubMed:21965678). Plays a role in the regulation of sumoylation status of SETX (PubMed:24105744). {ECO:0000269|PubMed:11451954, ECO:0000269|PubMed:18538659, ECO:0000269|PubMed:21965678}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Alternative sequence (1); Beta strand (7); Chain (1); Cross-link (5); Domain (1); Helix (2); Mutagenesis (3); Natural variant (1); Propeptide (1); Sequence conflict (2); Turn (2) |
| Keywords | 3D-structure;Alternative splicing;Cytoplasm;Isopeptide bond;Nucleus;Reference proteome;Ubl conjugation;Ubl conjugation pathway |
| Interact With | P54253; Q99700-5; A4D161; P42858; O43290; Q9HC62; P23497; Q5W0Q7; Q86T24; O15060; Q6PEW1; Q96IT1; P62990 |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm. Nucleus. Nucleus, PML body {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Polymeric chains can be formed through Lys-11 cross-linking.; PTM: Cleavage of precursor form by SENP1, SENP2 or SENP5 is necessary for function. {ECO:0000269|PubMed:15487983, ECO:0000269|PubMed:16608850}. |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (3); X-ray crystallography (2) |
| Cross Reference PDB | 1U4A; 2IO1; 2MP2; 6K5R; 6NNQ; |
| Mapped Pubmed ID | 10187858; 11889051; 11896061; 12032081; 12192048; 12511558; 12641448; 14563852; 14578449; 14701874; 15383276; 15456902; 15660128; 15829507; 15940266; 16030353; 16055710; 16154602; 16169070; 16253240; 16626738; 16738315; 16738331; 17000644; 17012228; 17099700; 17164289; 17183683; 17218271; 17353931; 17535915; 17591783; 17643372; 18274552; 18374647; 18381449; 18408014; 18565875; 18694876; 18707152; 18708356; 18842587; 18946085; 19029252; 19107418; 19240082; 19345186; 19443651; 19597476; 19635839; 19680224; 19706679; 19779455; 19919826; 19956565; 20016594; 20016603; 20056645; 20098713; 20159957; 20164921; 20176810; 20181954; 20351170; 20360068; 20501649; 20663916; 20705237; 20719936; 21147198; 21291420; 21527249; 21554500; 21878624; 21900206; 21900752; 22291911; 22296450; 22306003; 22370726; 22464730; 22492558; 22635276; 22649547; 22661230; 22685230; 22878415; 22930759; 23077236; 23078246; 23407422; 23750026; 23751493; 23990779; 24027577; 24257756; 24267727; 24782567; 24942926; 24969970; 25047847; 25380826; 25391492; 25406032; 25410875; 25416956; 25533185; 25556234; 26042670; 26151477; 26223632; 26223657; 26458400; 26867680; 27247387; 28455449; 28665748; 28747609; 29326161; 29574511; 29891701; 29943150; 30403549; 30761470; 30926672; 31045562; 31371453; 31752909; 31806367; 32197837; 32237992; 32641734; 33326746; 9452416; 9920803; |
| Motif | |
| Gene Encoded By | |
| Mass | 11,637 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |