| IED ID | IndEnz0002010728 |
| Enzyme Type ID | protease010728 |
| Protein Name |
Toxic protein SymE Putative endoribonuclease SymE EC 3.1.-.- |
| Gene Name | symE dinL sosC yjiW b4347 JW4310 |
| Organism | Escherichia coli (strain K12) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Enterobacterales Enterobacteriaceae Escherichia Escherichia coli Escherichia coli (strain K12) |
| Enzyme Sequence | MTDTHSIAQPFEAEVSPANNRHVTVGYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAEESELMQSLRQVCKLSARKQKQVQAFIGVIAGKQKVA |
| Enzyme Length | 113 |
| Uniprot Accession Number | P39394 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.1.-.- |
| Enzyme Function | FUNCTION: Toxic component of a type I toxin-antitoxin (TA) system (PubMed:17462020). Involved in the degradation and recycling of damaged RNA (PubMed:17462020). It is itself a target for degradation by the ATP-dependent protease Lon (PubMed:17462020). {ECO:0000269|PubMed:17462020}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Domain (1); Erroneous initiation (2) |
| Keywords | Cytoplasm;DNA-binding;Endonuclease;Hydrolase;Nuclease;RNA-binding;Reference proteome;Toxin-antitoxin system |
| Interact With | |
| Induction | INDUCTION: Repressed by LexA, induced by DNA damage (PubMed:10760155, PubMed:17462020). During the SOS response (at protein level when expressed as a fusion protein) (PubMed:17462020). The mRNA stability and translation is controlled by the small regulatory RNA symR, which probably blocks ribosome binding (PubMed:17462020). Expression of the proteinaceous toxin (putative endonuclease) is controlled by antisense sRNA SymR (PubMed:17462020). {ECO:0000269|PubMed:10760155, ECO:0000269|PubMed:17462020}. |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000305|PubMed:17462020}. Note=Purifies with ribosomes. {ECO:0000269|PubMed:17462020}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,203 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |