| IED ID | IndEnz0002010736 |
| Enzyme Type ID | protease010736 |
| Protein Name |
Thrombin-like enzyme stejnobin SVTLE EC 3.4.21.- Fibrinogen-clotting enzyme Snake venom serine protease SVSP |
| Gene Name | |
| Organism | Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Viperidae Crotalinae (pit vipers) Trimeresurus Trimeresurus stejnegeri (Chinese green tree viper) (Viridovipera stejnegeri) |
| Enzyme Sequence | MMLIRVLANLLILQLSYAQKSSELVIGGDECNINEHRFLVALYDFWSGDFLCGGTLINQEYVLTAAHCKTRNMYIYLGMHNKSVQFDDEQRRYPKKKYFFRCRNNFTRWDKDIMLIRLNRPVRNSAHIAPLSLPSSPPTVGSVCRVMGWGTITSPNETLPDVPRCANINLFNYTVCHGVFPWLPARSRILCAGVLQGGIDTCKRDSGGPLICNGQFQGIVSWGPKPCAQPRKPALYTKVFDHLDWIQSIIAGNTTVTCPP |
| Enzyme Length | 260 |
| Uniprot Accession Number | Q8AY81 |
| Absorption | |
| Active Site | ACT_SITE 67; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 112; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 206; /note=Charge relay system; /evidence=ECO:0000250 |
| Activity Regulation | ACTIVITY REGULATION: Its activity is inhibited by diisopropylfluorophosphate (DFP) and PMSF, whereas EDTA has no effect on it. {ECO:0000269|PubMed:9604287}. |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.21.- |
| Enzyme Function | FUNCTION: Thrombin-like snake venom serine protease that has fibrinogen-clotting activity (FGA or FGB). {ECO:0000269|PubMed:9604287}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Chain (1); Disulfide bond (6); Domain (1); Glycosylation (5); Propeptide (1); Signal peptide (1) |
| Keywords | Blood coagulation cascade activating toxin;Direct protein sequencing;Disulfide bond;Glycoprotein;Hemostasis impairing toxin;Hydrolase;Protease;Secreted;Serine protease;Signal;Toxin;Zymogen |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000269|PubMed:9604287}. |
| Modified Residue | |
| Post Translational Modification | PTM: Glycosylated. {ECO:0000269|PubMed:9604287}. |
| Signal Peptide | SIGNAL 1..18; /evidence=ECO:0000255 |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 29,328 |
| Kinetics | BIOPHYSICOCHEMICAL PROPERTIES: Kinetic parameters: KM=250 uM for H-D-Phe-Pip-Arg-pNA (S-2238) {ECO:0000269|PubMed:9604287}; KM=50 uM for H-D-Pro-Phe-Arg-pNA (S-2302) {ECO:0000269|PubMed:9604287}; KM=125 uM for H-D-Val-Leu-Arg-pNA (S-2266) {ECO:0000269|PubMed:9604287}; |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |