| IED ID | IndEnz0002010747 |
| Enzyme Type ID | protease010747 |
| Protein Name |
Kunitz-type serine protease inhibitor textilinin-1 Txln-1 |
| Gene Name | |
| Organism | Pseudonaja textilis textilis (Eastern brown snake) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Acanthophiinae Pseudonaja Pseudonaja textilis (Eastern brown snake) Pseudonaja textilis textilis (Eastern brown snake) |
| Enzyme Sequence | MSSGGLLLLLGLLTLWEVLTPVSSKDRPDFCELPADTGPCRVRFPSFYYNPDEKKCLEFIYGGCEGNANNFITKEECESTCAA |
| Enzyme Length | 83 |
| Uniprot Accession Number | Q90WA1 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Strongly inhibits plasmin (Ki=0.44 nM) and trypsin (Ki=0.42 nM). Has little effect on plasma (Ki=1870 nM) and tissue (Ki=12900 nM) kallikreins. In vivo, reduces bleeding in a small animal model. {ECO:0000269|PubMed:10847427, ECO:0000269|PubMed:12406072, ECO:0000269|PubMed:16707925, ECO:0000269|PubMed:19236611, ECO:0000269|PubMed:21843588, ECO:0000269|PubMed:23335990}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (3); Domain (1); Helix (2); Signal peptide (1); Site (1); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Hemostasis impairing toxin;Pharmaceutical;Protease inhibitor;Secreted;Serine protease inhibitor;Signal;Toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..24; /evidence=ECO:0000269|PubMed:10847427 |
| Structure 3D | X-ray crystallography (4) |
| Cross Reference PDB | 3BYB; 3D65; 3UIR; 5ZJ3; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 9,173 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |