| IED ID | IndEnz0002010791 |
| Enzyme Type ID | protease010791 |
| Protein Name |
Anti-sigma-E factor RseA Regulator of SigE Sigma-E anti-sigma factor RseA Sigma-E factor negative regulatory protein |
| Gene Name | rseA mclA HI_0629 |
| Organism | Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Taxonomic Lineage | cellular organisms Bacteria Proteobacteria Gammaproteobacteria Pasteurellales Pasteurellaceae Haemophilus Haemophilus influenzae Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) |
| Enzyme Sequence | MQKEQLSAYMDGEQVETDLIDALLRDEELQASWHSFHTVRSVMRKESAVFLGADFTAKMADLIELEDVKKVDVIAVSQPEPEDAHNSVFMQKLKAFFAPMTQVAVAAGVCLVAVLGVQSFNNKNDASNLPETPVLQTLPFNNAVQEVSYNAPSKDTLTSDQLEKKSRRIGAMLQNYELQRRMHSDALDVSSSQVR |
| Enzyme Length | 195 |
| Uniprot Accession Number | P44791 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: An anti-sigma factor for extracytoplasmic function (ECF) sigma factor sigma-E (RpoE). ECF sigma factors are held in an inactive form by an anti-sigma factor until released by regulated intramembrane proteolysis (RIP). RIP occurs when an extracytoplasmic signal triggers a concerted proteolytic cascade to transmit information and elicit cellular responses. The membrane-spanning regulatory substrate protein is first cut periplasmically (site-1 protease, S1P, DegS), then within the membrane itself (site-2 protease, S2P, RseP), while cytoplasmic proteases finish degrading the anti-sigma factor, liberating sigma-E (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Coiled coil (1); Site (1); Topological domain (2); Transmembrane (1) |
| Keywords | Cell inner membrane;Cell membrane;Coiled coil;Membrane;Reference proteome;Signal-anchor;Transcription;Transcription regulation;Transmembrane;Transmembrane helix |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cell inner membrane {ECO:0000250}; Single-pass type II membrane protein {ECO:0000250}. Note=Following cleavage by DegS the large fragment of the protein is still in the inner membrane and retains its anti-sigma-E activity. {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | PTM: Sequentially cleaved by DegS (a site-1 protease) in its periplasmic domain between Val-147 and Ser-148, then by RseP (a site-2 protease). The N-terminal fragment is then degraded by primarily ClpX-ClpP in an ATP-dependent fashion. Sequential cleavage by DegS, RseP and ClpX-ClpP frees RpoE from RseA (By similarity). {ECO:0000250}. |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 21,733 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |