| IED ID | IndEnz0002010792 |
| Enzyme Type ID | protease010792 |
| Protein Name |
Staphylokinase Neutral proteinase Protease III SakSTAR |
| Gene Name | sak |
| Organism | Staphylococcus aureus |
| Taxonomic Lineage | cellular organisms Bacteria Terrabacteria group Firmicutes Bacilli Bacillales Staphylococcaceae Staphylococcus Staphylococcus aureus |
| Enzyme Sequence | MLKRSLLFLTVLLLLFSFSSITNEVSASSSFDKGKYKKGDDASYFEPTGPYLMVNVTGVDGKGNELLSPHYVEFPIKPGTTLTKEKIEYYVEWALDATAYKEFRVVELDPSAKIEVTYYDKNKKKEETKSFPITEKGFVVPDLSEHIKNPGFNLITKVVIEKK |
| Enzyme Length | 163 |
| Uniprot Accession Number | P68802 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Potent plasminogen activator that converts plasminogen into plasmin. It forms a 1:1 complex with plasmin, which in turn activates other plasminogen molecules. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (8); Chain (1); Helix (2); Signal peptide (1); Turn (3) |
| Keywords | 3D-structure;Pharmaceutical;Plasminogen activation;Secreted;Signal |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | SIGNAL 1..27 |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (5) |
| Cross Reference PDB | 1C76; 1C77; 1C78; 1C79; 1SSN; 2SAK; |
| Mapped Pubmed ID | 11856331; |
| Motif | |
| Gene Encoded By | |
| Mass | 18,490 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |