| IED ID | IndEnz0002010882 |
| Enzyme Type ID | protease010882 |
| Protein Name |
Whey acidic protein WAP |
| Gene Name | WAP |
| Organism | Camelus dromedarius (Dromedary) (Arabian camel) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Laurasiatheria Artiodactyla Tylopoda Camelidae Camelus Camelus dromedarius (Dromedary) (Arabian camel) |
| Enzyme Sequence | LAPALSLPGQAVCPELSSSEDNACIISCVNDESCPQGTKCCARSPCSRSCTVPLMVSSPEPVLKDGRCPWVQTPLTAKHCLEKNDCSRDDQCEGNKKCCFSSCAMRCLDPVTEDSFQ |
| Enzyme Length | 117 |
| Uniprot Accession Number | P09837 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Could be a protease inhibitor. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Disulfide bond (8); Domain (2) |
| Keywords | Direct protein sequencing;Disulfide bond;Milk protein;Protease inhibitor;Repeat;Secreted |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 12,564 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |