| IED ID | IndEnz0002010915 |
| Enzyme Type ID | protease010915 |
| Protein Name |
Putative proteasome subunit alpha type-4-B 20S proteasome alpha subunit C-2 Proteasome subunit alpha type-3 |
| Gene Name | PAC2 At4g15165 dl3625w FCAALL.211 |
| Organism | Arabidopsis thaliana (Mouse-ear cress) |
| Taxonomic Lineage | cellular organisms Eukaryota Viridiplantae Streptophyta Streptophytina Embryophyta Tracheophyta Euphyllophyta Spermatophyta Magnoliopsida Mesangiospermae eudicotyledons Gunneridae Pentapetalae rosids malvids Brassicales Brassicaceae Camelineae Arabidopsis Arabidopsis thaliana (Mouse-ear cress) |
| Enzyme Sequence | MSRRYDSRTTIFSPEGRLYQVEYAMEAIGNAGSAIGILAKDGVVLVGEKKVTSKLLQTSSSMEKMYKIDDHVACAVAGIMSDANILINTARVQAQRWDRNHGFQLYMSDPSGNYGGWQAAAVGANNQAAQSILKQDYKDDATREEVVQLAIKVLSKTMDSTSLTAEKLELAELYLTPSKCVKYHVHSPDSLTKLLVKHGVTQPAAETS |
| Enzyme Length | 208 |
| Uniprot Accession Number | F4JJE5 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity (By similarity). {ECO:0000250}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Erroneous gene model prediction (2) |
| Keywords | Cytoplasm;Nucleus;Proteasome;Reference proteome |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Cytoplasm {ECO:0000250}. Nucleus {ECO:0000250}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 16623885; |
| Motif | |
| Gene Encoded By | |
| Mass | 22,731 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |