| IED ID | IndEnz0002010994 |
| Enzyme Type ID | protease010994 |
| Protein Name |
Ovostatin Ovomacroglobulin Fragment |
| Gene Name | |
| Organism | Anas platyrhynchos (Mallard) (Anas boschas) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Archelosauria Archosauria Dinosauria Saurischia Theropoda Coelurosauria Aves Neognathae Galloanserae Anseriformes (ducks geese and swans) Anatidae (waterfowl) Anatinae Anas (ducks) Anas platyrhynchos (Mallard) (Anas boschas) |
| Enzyme Sequence | ASFSVVGDIMGTSMQNLHQLLQMPFGCGEQNM |
| Enzyme Length | 32 |
| Uniprot Accession Number | P20739 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Is able to inhibit all four classes of proteinases by a unique 'trapping' mechanism. This protein has a peptide stretch, called the 'bait region' which contains specific cleavage sites for different proteinases. When a proteinase cleaves the bait region, a conformational change is induced in the protein which traps the proteinase. The entrapped enzyme remains active against low molecular weight substrates (activity against high molecular weight substrates is greatly reduced). Following cleavage in the bait region a thioester bond is hydrolyzed and mediates the covalent binding of the protein to the proteinase. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Chain (1); Cross-link (1); Non-terminal residue (2) |
| Keywords | Bait region;Direct protein sequencing;Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Thioester bond |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,472 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |