| IED ID | IndEnz0002011014 |
| Enzyme Type ID | protease011014 |
| Protein Name |
Thermomycolin EC 3.4.21.65 Thermomycolase Fragments |
| Gene Name | |
| Organism | Malbranchea cinnamomea (Thermophilic fungus) (Malbranchea sulfurea) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Fungi Dikarya Ascomycota saccharomyceta Pezizomycotina leotiomyceta Eurotiomycetes Eurotiomycetidae Onygenales Onygenales incertae sedis Malbranchea Malbranchea cinnamomea (Thermophilic fungus) (Malbranchea sulfurea) |
| Enzyme Sequence | ALVTQSNAPSWGLGRISNRQAGIRDYHYLSGTSM |
| Enzyme Length | 34 |
| Uniprot Accession Number | P13858 |
| Absorption | |
| Active Site | ACT_SITE 33; /note="Charge relay system"; /evidence="ECO:0000255|PROSITE-ProRule:PRU10080, ECO:0000255|PROSITE-ProRule:PRU10081, ECO:0000255|PROSITE-ProRule:PRU10082, ECO:0000269|PubMed:1012007" |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Rather non-specific hydrolysis of proteins. Preferential cleavage: -Ala-|-Xaa-, -Tyr-|-Xaa-, -Phe-|-Xaa- in small molecular substrates.; EC=3.4.21.65; |
| DNA Binding | |
| EC Number | 3.4.21.65 |
| Enzyme Function | FUNCTION: This is an extracellular proteinase with a general specificity for apolar residues. |
| Temperature Dependency | BIOPHYSICOCHEMICAL PROPERTIES: Temperature dependence: Thermostable.; |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (1); Chain (1); Non-adjacent residues (1); Non-terminal residue (1); Sequence uncertainty (4) |
| Keywords | Direct protein sequencing;Hydrolase;Protease;Secreted;Serine protease |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 3,708 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |