| IED ID |
IndEnz0002011033 |
| Enzyme Type ID |
protease011033 |
| Protein Name |
Kunitz-type serine protease inhibitor nigrescinin-3
|
| Gene Name |
|
| Organism |
Cryptophis nigrescens (Eastern small-eyed snake) (Rhinoplocephalus nigrescens) |
| Taxonomic Lineage |
cellular organisms
Eukaryota
Opisthokonta
Metazoa
Eumetazoa
Bilateria
Deuterostomia
Chordata
Craniata
Vertebrata
Gnathostomata (jawed vertebrates)
Teleostomi
Euteleostomi
Sarcopterygii
Dipnotetrapodomorpha
Tetrapoda
Amniota
Sauropsida
Sauria (diapsids)
Lepidosauria (lepidosaurs)
Squamata (squamates)
Bifurcata (split-tongued squamates)
Unidentata
Episquamata
Toxicofera
Serpentes (snakes)
Colubroidea
Elapidae
Cryptophis
Cryptophis nigrescens (Eastern small-eyed snake) (Rhinoplocephalus nigrescens)
|
| Enzyme Sequence |
MSSGGLLLLLGLLTLWEALTPVSSTDRPEFCELPEDSGPCKGLFHVFYYNSDQNQRLEFIYGGCYGNANNFKTIEECKRTCAA |
| Enzyme Length |
83 |
| Uniprot Accession Number |
B5KL34 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Serine protease inhibitor. {ECO:0000250}. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Disulfide bond (2); Domain (1); Signal peptide (1); Site (1) |
| Keywords |
Disulfide bond;Protease inhibitor;Secreted;Serine protease inhibitor;Signal |
| Interact With |
|
| Induction |
|
| Subcellular Location |
SUBCELLULAR LOCATION: Secreted {ECO:0000250}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..24; /evidence=ECO:0000255 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
9,245 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|