| IED ID | IndEnz0002011043 |
| Enzyme Type ID | protease011043 |
| Protein Name |
PI-stichotoxin-She2a PI-SHTX-She2a Kunitz-type protease inhibitor ShPI-I |
| Gene Name | |
| Organism | Stichodactyla helianthus (Sun anemone) (Stoichactis helianthus) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Stichodactyla Stichodactyla helianthus (Sun anemone) (Stoichactis helianthus) |
| Enzyme Sequence | SICSEPKKVGRCKGYFPRFYFDSETGKCTPFIYGGCGGNGNNFETLHQCRAICRA |
| Enzyme Length | 55 |
| Uniprot Accession Number | P31713 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Active against serine, cysteine, and aspartic proteases. Can bind vertebrate trypsin and chymotrypsin. {ECO:0000269|PubMed:22975140, ECO:0000269|PubMed:9027993}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (3); Domain (1); Helix (2); Site (1); Turn (1) |
| Keywords | 3D-structure;Aspartic protease inhibitor;Direct protein sequencing;Disulfide bond;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|PubMed:9027993}. Nematocyst {ECO:0000305}. |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | NMR spectroscopy (1); X-ray crystallography (4) |
| Cross Reference PDB | 1SHP; 3M7Q; 3OFW; 3T62; 3UOU; |
| Mapped Pubmed ID | 25878249; |
| Motif | |
| Gene Encoded By | |
| Mass | 6,116 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |