IED ID | IndEnz0002011046 |
Enzyme Type ID | protease011046 |
Protein Name |
Core protein VP8 25 kDa major core protein L4 core protein P25K |
Gene Name | L4R |
Organism | Vaccinia virus (strain Copenhagen) (VACV) |
Taxonomic Lineage | Viruses Varidnaviria Bamfordvirae Nucleocytoviricota Pokkesviricetes Chitovirales Poxviridae Chordopoxvirinae Orthopoxvirus Vaccinia virus Vaccinia virus (strain Copenhagen) (VACV) |
Enzyme Sequence | MSLLLENLIEEDTIFFAGSISEYDDLQMVIAGAKSKFPRSMLSIFNIVPRTMSKYELELIHNENITGAMFTTMYNIRNNLGLGDDKLTIEAIENYFLDPNNEVMPLIINNTDMTAVIPKKSGRRKNKNMVIFRQGSSPILCIFETRKKINIYKENMESASTEYTPIGDNKALISKYAGINVLNVYSPSTSMRLNAIYGFTNKNKLEKLSTNKELESYSSSPLQEPIRLNDFLGLLECVKKNIPLTDIPTKD |
Enzyme Length | 251 |
Uniprot Accession Number | P20981 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Major core structural protein. {ECO:0000250}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Propeptide (1); Site (2) |
Keywords | Late protein;Reference proteome;Virion |
Interact With | |
Induction | INDUCTION: Expressed in the late phase of the viral replicative cycle. |
Subcellular Location | SUBCELLULAR LOCATION: Virion {ECO:0000250}. Note=Localizes to the virion core. {ECO:0000250}. |
Modified Residue | |
Post Translational Modification | PTM: Undergoes morphogenesis-associated proteolysis which cleaves the 28 kDa to a 25-kDa product. Proteolytic cleavage of major core proteins P4a (A10L), P4b (A3L), and VP8 (L4R), which occurs at a late stage of core formation, is required for production of infectious mature virions (MV) (By similarity). {ECO:0000250}. |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 28,461 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |