IED ID | IndEnz0002011052 |
Enzyme Type ID | protease011052 |
Protein Name |
PI-stichotoxin-She2b PI-SHTX-She2b Kunitz-type protease inhibitor SHPI-2 |
Gene Name | |
Organism | Stichodactyla helianthus (Sun anemone) (Stoichactis helianthus) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Cnidaria Anthozoa (anthozoans) Hexacorallia Actiniaria (sea anemones) Stichodactylidae Stichodactyla Stichodactyla helianthus (Sun anemone) (Stoichactis helianthus) |
Enzyme Sequence | SFCLEPKRVGRCKGYFPRFYFDSKTGKCTPFIYGGCGGNGNNFETLHQCRAICRA |
Enzyme Length | 55 |
Uniprot Accession Number | P81129 |
Absorption | |
Active Site | |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | |
DNA Binding | |
EC Number | |
Enzyme Function | FUNCTION: Inhibitor of serine, cysteine, and aspartic proteinases. {ECO:0000269|Ref.1}. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Chain (1); Disulfide bond (3); Domain (1); Site (1) |
Keywords | Aspartic protease inhibitor;Direct protein sequencing;Disulfide bond;Nematocyst;Protease inhibitor;Secreted;Serine protease inhibitor |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted {ECO:0000305|Ref.1}. Nematocyst {ECO:0000305}. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 6,203 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |