IED ID | IndEnz0002011080 |
Enzyme Type ID | protease011080 |
Protein Name |
Trypsin CFT-1 EC 3.4.21.4 |
Gene Name | |
Organism | Choristoneura fumiferana (Spruce budworm moth) (Archips fumiferana) |
Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Panarthropoda Arthropoda Mandibulata Pancrustacea Hexapoda Insecta Dicondylia Pterygota (winged insects) Neoptera Endopterygota Amphiesmenoptera Lepidoptera (butterflies and moths) Glossata Neolepidoptera Heteroneura Ditrysia Apoditrysia Tortricoidea Tortricidae Tortricinae Archipini Choristoneura Choristoneura fumiferana (Spruce budworm moth) (Archips fumiferana) |
Enzyme Sequence | MRVTLALVALCLASVAALPEKQQRIVGGSVTTIEQWPSGSALLYSWNLVTYSQACGGAILNTRSILSAAHCFIGDAANRWRIRTGSTWANSGGVVHNTALIIIHPSYNTRTLDNDIAILRSATTIAQNNQARPASIAGANYNLADNQAVWAIGWGATCPGCAGSEQLRHIQIWTVNQNTCRSRYLEVGGTITDNMLCSGWLDVGGRDQCQGDSGGPLFHNNVVVGVCSWGQSCALARYPGVNARVSRFTAWIQANA |
Enzyme Length | 256 |
Uniprot Accession Number | P35042 |
Absorption | |
Active Site | ACT_SITE 70; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 115; /note=Charge relay system; /evidence=ECO:0000250; ACT_SITE 213; /note=Charge relay system; /evidence=ECO:0000250 |
Activity Regulation | |
Binding Site | |
Calcium Binding | |
catalytic Activity | CATALYTIC ACTIVITY: Reaction=Preferential cleavage: Arg-|-Xaa, Lys-|-Xaa.; EC=3.4.21.4; |
DNA Binding | |
EC Number | 3.4.21.4 |
Enzyme Function | FUNCTION: Responsible for the activation of delta-endotoxin from Bacillus thuringiensis. |
Temperature Dependency | |
PH Dependency | |
Pathway | |
nucleotide Binding | |
Features | Active site (3); Chain (1); Disulfide bond (3); Domain (1); Propeptide (1); Signal peptide (1); Site (1) |
Keywords | Direct protein sequencing;Disulfide bond;Hydrolase;Protease;Secreted;Serine protease;Signal;Zymogen |
Interact With | |
Induction | |
Subcellular Location | SUBCELLULAR LOCATION: Secreted, extracellular space. |
Modified Residue | |
Post Translational Modification | |
Signal Peptide | SIGNAL 1..17; /evidence=ECO:0000255 |
Structure 3D | |
Cross Reference PDB | - |
Mapped Pubmed ID | - |
Motif | |
Gene Encoded By | |
Mass | 27,333 |
Kinetics | |
Metal Binding | |
Rhea ID | |
Cross Reference Brenda |