| IED ID | IndEnz0002011093 |
| Enzyme Type ID | protease011093 |
| Protein Name |
Ubiquitin carboxyl-terminal hydrolase ubh-4 EC 3.4.19.12 Ubiquitin C-terminal hydrolase family 1 member 4 Ubiquitin thioesterase 4 |
| Gene Name | ubh-4 C08B11.7 |
| Organism | Caenorhabditis elegans |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Protostomia Ecdysozoa Nematoda (roundworms) Chromadorea Rhabditida Rhabditina Rhabditomorpha Rhabditoidea Rhabditidae Peloderinae Caenorhabditis Caenorhabditis elegans |
| Enzyme Sequence | MTDAGSWCLIESDPGVFTEMLRGFGVDGLQVEELYSLDDDKAMTRPTYGLIFLFKWRQGDETTGIPSDKQNIFFAHQTIQNACATQALINLLMNVEDTDVKLGNILNQYKEFAIDLDPNTRGHCLSNSEEIRTVHNSFSRQTLFELDIKGGESEDNYHFVTYVPIGNKVYELDGLRELPLEVAEFQKEQDWIEAIKPVIQQRMQKYSEGEITFNLMALVPNRKQKLQEMMENLIQANENNELEEQIADLNKAIADEDYKMEMYRKENNRRRHNYTPFVIELMKILAKEGKLVGLVDNAYQAAKEKSKLNTDITKLELKRKQ |
| Enzyme Length | 321 |
| Uniprot Accession Number | Q09444 |
| Absorption | |
| Active Site | ACT_SITE 83; /note=Nucleophile; /evidence=ECO:0000250|UniProtKB:P09936; ACT_SITE 158; /note=Proton donor; /evidence=ECO:0000250|UniProtKB:P09936 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | CATALYTIC ACTIVITY: Reaction=Thiol-dependent hydrolysis of ester, thioester, amide, peptide and isopeptide bonds formed by the C-terminal Gly of ubiquitin (a 76-residue protein attached to proteins as an intracellular targeting signal).; EC=3.4.19.12; Evidence={ECO:0000305|PubMed:23770237}; |
| DNA Binding | |
| EC Number | 3.4.19.12 |
| Enzyme Function | FUNCTION: Ubiquitin-protein hydrolase involved both in the processing of ubiquitin precursors and of ubiquitinated proteins. This enzyme is a thiol protease that recognizes and hydrolyzes a peptide bond at the C-terminal glycine of ubiquitin. {ECO:0000305|PubMed:23770237}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (2); Chain (1); Site (1) |
| Keywords | Hydrolase;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | INDUCTION: Expression decreases with age. {ECO:0000269|PubMed:23770237}. |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | |
| Cross Reference PDB | - |
| Mapped Pubmed ID | 11231151; 14704431; 15998808; 21085631; 21177967; 22286215; 22560298; 23604319; 23800452; 25487147; 26351692; 30140741; 31283754; |
| Motif | |
| Gene Encoded By | |
| Mass | 37,120 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |