| IED ID | IndEnz0002011096 |
| Enzyme Type ID | protease011096 |
| Protein Name |
Ufm1-specific protease 1 UfSP1 EC 3.4.22.- |
| Gene Name | Ufsp1 D5Ertd655e |
| Organism | Mus musculus (Mouse) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Mammalia Theria Eutheria Boreoeutheria Euarchontoglires Glires (Rodents and rabbits) Rodentia Myomorpha (mice and others) Muroidea Muridae Murinae Mus Mus Mus musculus (Mouse) |
| Enzyme Sequence | MTAALPSTLELLKDVHLGLPVPCHDPARLALLSGHYLYYHYGCDGLDDRGWGCGYRTLQTLCSWPGGQSSGVPGLPALQGALEAMGDKPPGFRGSRNWIGCVEASLCLEHFGGPQGRLCHLPRGVGLRGEEERLYSHFTTGGGPVMVGGDADAQSKALLGICEGPGSEVYVLILDPHYWGTPKNRCELQAAGWVGWQKVKSVFDSNSFYNLCFTRNL |
| Enzyme Length | 217 |
| Uniprot Accession Number | Q9CZP0 |
| Absorption | |
| Active Site | ACT_SITE 53; ACT_SITE 175; ACT_SITE 177 |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | 3.4.22.- |
| Enzyme Function | FUNCTION: Thiol protease which recognizes and hydrolyzes the peptide bond at the C-terminal Gly of UFM1, a ubiquitin-like modifier protein bound to a number of target proteins. Does not hydrolyze SUMO1 or ISG15 ubiquitin-like proteins. {ECO:0000269|PubMed:17182609}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Active site (3); Beta strand (8); Chain (1); Helix (6); Mutagenesis (6); Turn (6) |
| Keywords | 3D-structure;Hydrolase;Protease;Reference proteome;Thiol protease;Ubl conjugation pathway |
| Interact With | |
| Induction | |
| Subcellular Location | |
| Modified Residue | |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 2Z84; |
| Mapped Pubmed ID | 10725249; 11217851; 12466851; 12520002; 18973680; 20018847; 21267068; 30635284; |
| Motif | |
| Gene Encoded By | |
| Mass | 23,421 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |