| IED ID | IndEnz0002011117 |
| Enzyme Type ID | protease011117 |
| Protein Name |
Kunitz-type serine protease inhibitor homolog alpha-dendrotoxin Alpha-DTX Protease inhibitor 1 homolog Toxin C13S2C3 Venom basic protease inhibitor 1 homolog |
| Gene Name | |
| Organism | Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Taxonomic Lineage | cellular organisms Eukaryota Opisthokonta Metazoa Eumetazoa Bilateria Deuterostomia Chordata Craniata Vertebrata Gnathostomata (jawed vertebrates) Teleostomi Euteleostomi Sarcopterygii Dipnotetrapodomorpha Tetrapoda Amniota Sauropsida Sauria (diapsids) Lepidosauria (lepidosaurs) Squamata (squamates) Bifurcata (split-tongued squamates) Unidentata Episquamata Toxicofera Serpentes (snakes) Colubroidea Elapidae Elapinae Dendroaspis Dendroaspis angusticeps (Eastern green mamba) (Naja angusticeps) |
| Enzyme Sequence | QPRRKLCILHRNPGRCYDKIPAFYYNQKKKQCERFDWSGCGGNSNRFKTIEECRRTCIG |
| Enzyme Length | 59 |
| Uniprot Accession Number | P00980 |
| Absorption | |
| Active Site | |
| Activity Regulation | |
| Binding Site | |
| Calcium Binding | |
| catalytic Activity | |
| DNA Binding | |
| EC Number | |
| Enzyme Function | FUNCTION: Serine protease inhibitor homolog that blocks voltage-gated potassium channels (Kv1.1/KCNA1, Kv1.2/KCNA2, and Kv1.6/KCNA6) (IC(50)=0.4-150 nM) and facilitates neurotransmitter release. {ECO:0000269|PubMed:10936620, ECO:0000269|PubMed:23771044}. |
| Temperature Dependency | |
| PH Dependency | |
| Pathway | |
| nucleotide Binding | |
| Features | Beta strand (4); Chain (1); Disulfide bond (3); Domain (1); Helix (2); Modified residue (1); Site (3); Turn (1) |
| Keywords | 3D-structure;Direct protein sequencing;Disulfide bond;Ion channel impairing toxin;Neurotoxin;Potassium channel impairing toxin;Pyrrolidone carboxylic acid;Secreted;Toxin;Voltage-gated potassium channel impairing toxin |
| Interact With | |
| Induction | |
| Subcellular Location | SUBCELLULAR LOCATION: Secreted. |
| Modified Residue | MOD_RES 1; /note=Pyrrolidone carboxylic acid; /evidence=ECO:0000269|PubMed:7429422 |
| Post Translational Modification | |
| Signal Peptide | |
| Structure 3D | X-ray crystallography (1) |
| Cross Reference PDB | 1DTX; |
| Mapped Pubmed ID | - |
| Motif | |
| Gene Encoded By | |
| Mass | 7,071 |
| Kinetics | |
| Metal Binding | |
| Rhea ID | |
| Cross Reference Brenda |