| IED ID |
IndEnz0002011160 |
| Enzyme Type ID |
protease011160 |
| Protein Name |
Probable amino-acid-binding protein YxeM
|
| Gene Name |
yxeM BSU39500 LP9E |
| Organism |
Bacillus subtilis (strain 168) |
| Taxonomic Lineage |
cellular organisms
Bacteria
Terrabacteria group
Firmicutes
Bacilli
Bacillales
Bacillaceae
Bacillus
Bacillus subtilis group
Bacillus subtilis
Bacillus subtilis subsp. subtilis
Bacillus subtilis (strain 168)
|
| Enzyme Sequence |
MKMKKWTVLVVAALLAVLSACGNGNSSSKEDDNVLHVGATGQSYPFAYKENGKLTGFDVEVMEAVAKKIDMKLDWKLLEFSGLMGELQTGKLDTISNQVAVTDERKETYNFTKPYAYAGTQIVVKKDNTDIKSVDDLKGKTVAAVLGSNHAKNLESKDPDKKINIKTYETQEGTLKDVAYGRVDAYVNSRTVLIAQIKKTGLPLKLAGDPIVYEQVAFPFAKDDAHDKLRKKVNKALDELRKDGTLKKLSEKYFNEDITVEQKH |
| Enzyme Length |
264 |
| Uniprot Accession Number |
P54952 |
| Absorption |
|
| Active Site |
|
| Activity Regulation |
|
| Binding Site |
|
| Calcium Binding |
|
| catalytic Activity |
|
| DNA Binding |
|
| EC Number |
|
| Enzyme Function |
FUNCTION: Probably part of the ABC transporter complex YxeMNO that could be involved in amino-acid import. May transport S-methylcysteine. |
| Temperature Dependency |
|
| PH Dependency |
|
| Pathway |
|
| nucleotide Binding |
|
| Features |
Chain (1); Lipidation (2); Signal peptide (1) |
| Keywords |
Amino-acid transport;Cell membrane;Lipoprotein;Membrane;Palmitate;Reference proteome;Signal;Transport |
| Interact With |
|
| Induction |
INDUCTION: More strongly expressed in the presence of methionine than in the presence of sulfate. {ECO:0000269|PubMed:12193636}. |
| Subcellular Location |
SUBCELLULAR LOCATION: Cell membrane {ECO:0000269|PubMed:22882210, ECO:0000305}; Lipid-anchor {ECO:0000305}. Membrane raft {ECO:0000269|PubMed:22882210}; Lipid-anchor {ECO:0000305}. Note=Present in detergent-resistant membrane (DRM) fractions that may be equivalent to eukaryotic membrane rafts; these rafts include proteins involved in signaling, molecule trafficking and protein secretion. {ECO:0000269|PubMed:22882210}. |
| Modified Residue |
|
| Post Translational Modification |
|
| Signal Peptide |
SIGNAL 1..20; /evidence=ECO:0000255|PROSITE-ProRule:PRU00303 |
| Structure 3D |
|
| Cross Reference PDB |
- |
| Mapped Pubmed ID |
- |
| Motif |
|
| Gene Encoded By |
|
| Mass |
29,311 |
| Kinetics |
|
| Metal Binding |
|
| Rhea ID |
|
| Cross Reference Brenda |
|